BLASTX nr result
ID: Mentha22_contig00032699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00032699 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41374.1| hypothetical protein MIMGU_mgv1a019582mg [Mimulus... 57 3e-06 >gb|EYU41374.1| hypothetical protein MIMGU_mgv1a019582mg [Mimulus guttatus] Length = 191 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 214 KTTVAKKLHIAPLPPTPPKVYKVDPVEFKDVVQKLT 321 K+ + KKL IAP+P TPPK+YKVDP +FKD VQKLT Sbjct: 61 KSFIPKKLPIAPIPRTPPKLYKVDPADFKDAVQKLT 96