BLASTX nr result
ID: Mentha22_contig00032681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00032681 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006477508.1| PREDICTED: uncharacterized protein LOC102618... 49 1e-07 gb|EYU45254.1| hypothetical protein MIMGU_mgv1a022355mg, partial... 58 2e-06 gb|EYU22094.1| hypothetical protein MIMGU_mgv1a025050mg [Mimulus... 58 2e-06 gb|EPS71014.1| hypothetical protein M569_03743, partial [Genlise... 58 2e-06 >ref|XP_006477508.1| PREDICTED: uncharacterized protein LOC102618710 [Citrus sinensis] Length = 552 Score = 49.3 bits (116), Expect(2) = 1e-07 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = -3 Query: 180 QRVKLYDTNRRHLDGRFPKRDEIVSSGESLLLDGHLVEI 64 +++ L+D R+ LD RF +RDE++ SGES+ DGHLVEI Sbjct: 186 RQIMLFDETRKLLDSRFLRRDEVIRSGESVSFDGHLVEI 224 Score = 32.0 bits (71), Expect(2) = 1e-07 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = -2 Query: 295 RERGLNISP*QKMIRDFKKSEMNKVCSSPSCMDMTKLGT 179 +++ +SP QK IRDFKK E++K + S + TK T Sbjct: 115 KKKKAQLSPSQKFIRDFKKRELHKYGTPRSSPETTKSET 153 >gb|EYU45254.1| hypothetical protein MIMGU_mgv1a022355mg, partial [Mimulus guttatus] Length = 203 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 180 QRVKLYDTNRRHLDGRFPKRDEIVSSGESLLLDGHLVEI 64 ++VKLYD N+RHLD RF K+DEIV SGESL +G+LVEI Sbjct: 122 RQVKLYDINKRHLDSRFLKKDEIVRSGESLPFEGYLVEI 160 >gb|EYU22094.1| hypothetical protein MIMGU_mgv1a025050mg [Mimulus guttatus] Length = 287 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 180 QRVKLYDTNRRHLDGRFPKRDEIVSSGESLLLDGHLVEI 64 ++VKLYD N+RHLD RF K+DEIV SGESL +G+LVEI Sbjct: 139 RQVKLYDINKRHLDSRFLKKDEIVRSGESLPFEGYLVEI 177 >gb|EPS71014.1| hypothetical protein M569_03743, partial [Genlisea aurea] Length = 178 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -3 Query: 180 QRVKLYDTNRRHLDGRFPKRDEIVSSGESLLLDGHLVEII 61 ++V LYD NR HL+ RF K+DEIVS+G+SL DGHLVEI+ Sbjct: 134 RQVMLYDANRMHLNSRFLKKDEIVSAGKSLAFDGHLVEIV 173