BLASTX nr result
ID: Mentha22_contig00032083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00032083 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39752.1| hypothetical protein MIMGU_mgv1a0027221mg, partia... 64 2e-08 ref|XP_006348193.1| PREDICTED: gamma-tubulin complex component 2... 62 1e-07 ref|XP_004232658.1| PREDICTED: gamma-tubulin complex component 2... 62 1e-07 ref|XP_006832876.1| hypothetical protein AMTR_s00095p00092040 [A... 61 1e-07 ref|XP_007029230.1| Gamma-tubulin complex component, putative is... 60 4e-07 ref|XP_007029229.1| Gamma-tubulin complex component, putative is... 60 4e-07 ref|XP_007029228.1| Gamma-tubulin complex component, putative is... 60 4e-07 ref|XP_007029227.1| Gamma-tubulin complex component, putative is... 60 4e-07 ref|XP_007029226.1| Gamma-tubulin complex component, putative is... 60 4e-07 ref|XP_006378638.1| hypothetical protein POPTR_0010s18810g [Popu... 59 7e-07 ref|XP_006378637.1| hypothetical protein POPTR_0010s18810g [Popu... 59 7e-07 ref|XP_002316177.1| hypothetical protein POPTR_0010s18810g [Popu... 59 7e-07 ref|XP_006487573.1| PREDICTED: gamma-tubulin complex component 2... 56 5e-06 ref|XP_006420823.1| hypothetical protein CICLE_v10004486mg [Citr... 56 5e-06 ref|XP_004162793.1| PREDICTED: LOW QUALITY PROTEIN: spindle pole... 56 5e-06 ref|XP_004148270.1| PREDICTED: spindle pole body component 97-li... 56 5e-06 gb|EPS65043.1| tubulin gamma complex-associated protein, partial... 56 6e-06 ref|XP_002529877.1| gamma-tubulin complex component, putative [R... 56 6e-06 >gb|EYU39752.1| hypothetical protein MIMGU_mgv1a0027221mg, partial [Mimulus guttatus] Length = 582 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 EL+SLGPILSSSSRAEPY+THLAQW+LGVGRD Sbjct: 551 ELESLGPILSSSSRAEPYLTHLAQWLLGVGRD 582 >ref|XP_006348193.1| PREDICTED: gamma-tubulin complex component 2-like [Solanum tuberosum] Length = 707 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 EL SLGPILSS SRAEPY+THLAQWILGVG+D Sbjct: 675 ELHSLGPILSSGSRAEPYLTHLAQWILGVGKD 706 >ref|XP_004232658.1| PREDICTED: gamma-tubulin complex component 2-like [Solanum lycopersicum] Length = 729 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 EL SLGPILSS SRAEPY+THLAQWILGVG+D Sbjct: 697 ELHSLGPILSSGSRAEPYLTHLAQWILGVGKD 728 >ref|XP_006832876.1| hypothetical protein AMTR_s00095p00092040 [Amborella trichopoda] gi|548837376|gb|ERM98154.1| hypothetical protein AMTR_s00095p00092040 [Amborella trichopoda] Length = 716 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSLGPILS+SS+AEPY+THLAQWILG+G D Sbjct: 684 ELQSLGPILSNSSQAEPYLTHLAQWILGIGND 715 >ref|XP_007029230.1| Gamma-tubulin complex component, putative isoform 5 [Theobroma cacao] gi|508717835|gb|EOY09732.1| Gamma-tubulin complex component, putative isoform 5 [Theobroma cacao] Length = 604 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSL PILSSSS+AEPY+THLAQWILGVG D Sbjct: 572 ELQSLRPILSSSSQAEPYLTHLAQWILGVGND 603 >ref|XP_007029229.1| Gamma-tubulin complex component, putative isoform 4 [Theobroma cacao] gi|508717834|gb|EOY09731.1| Gamma-tubulin complex component, putative isoform 4 [Theobroma cacao] Length = 612 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSL PILSSSS+AEPY+THLAQWILGVG D Sbjct: 580 ELQSLRPILSSSSQAEPYLTHLAQWILGVGND 611 >ref|XP_007029228.1| Gamma-tubulin complex component, putative isoform 3 [Theobroma cacao] gi|508717833|gb|EOY09730.1| Gamma-tubulin complex component, putative isoform 3 [Theobroma cacao] Length = 704 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSL PILSSSS+AEPY+THLAQWILGVG D Sbjct: 672 ELQSLRPILSSSSQAEPYLTHLAQWILGVGND 703 >ref|XP_007029227.1| Gamma-tubulin complex component, putative isoform 2 [Theobroma cacao] gi|508717832|gb|EOY09729.1| Gamma-tubulin complex component, putative isoform 2 [Theobroma cacao] Length = 711 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSL PILSSSS+AEPY+THLAQWILGVG D Sbjct: 679 ELQSLRPILSSSSQAEPYLTHLAQWILGVGND 710 >ref|XP_007029226.1| Gamma-tubulin complex component, putative isoform 1 [Theobroma cacao] gi|508717831|gb|EOY09728.1| Gamma-tubulin complex component, putative isoform 1 [Theobroma cacao] Length = 703 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSL PILSSSS+AEPY+THLAQWILGVG D Sbjct: 671 ELQSLRPILSSSSQAEPYLTHLAQWILGVGND 702 >ref|XP_006378638.1| hypothetical protein POPTR_0010s18810g [Populus trichocarpa] gi|550330115|gb|ERP56435.1| hypothetical protein POPTR_0010s18810g [Populus trichocarpa] Length = 710 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSLGPILS+SS+AEPY+THLAQWILG G D Sbjct: 678 ELQSLGPILSNSSQAEPYLTHLAQWILGDGHD 709 >ref|XP_006378637.1| hypothetical protein POPTR_0010s18810g [Populus trichocarpa] gi|550330114|gb|ERP56434.1| hypothetical protein POPTR_0010s18810g [Populus trichocarpa] Length = 697 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSLGPILS+SS+AEPY+THLAQWILG G D Sbjct: 665 ELQSLGPILSNSSQAEPYLTHLAQWILGDGHD 696 >ref|XP_002316177.1| hypothetical protein POPTR_0010s18810g [Populus trichocarpa] gi|222865217|gb|EEF02348.1| hypothetical protein POPTR_0010s18810g [Populus trichocarpa] Length = 711 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSLGPILS+SS+AEPY+THLAQWILG G D Sbjct: 679 ELQSLGPILSNSSQAEPYLTHLAQWILGDGHD 710 >ref|XP_006487573.1| PREDICTED: gamma-tubulin complex component 2-like isoform X1 [Citrus sinensis] gi|568868603|ref|XP_006487574.1| PREDICTED: gamma-tubulin complex component 2-like isoform X2 [Citrus sinensis] Length = 703 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSLGPILSSSS+AEPY+THLAQ +LGVG D Sbjct: 671 ELQSLGPILSSSSQAEPYLTHLAQLVLGVGFD 702 >ref|XP_006420823.1| hypothetical protein CICLE_v10004486mg [Citrus clementina] gi|567855409|ref|XP_006420824.1| hypothetical protein CICLE_v10004486mg [Citrus clementina] gi|557522696|gb|ESR34063.1| hypothetical protein CICLE_v10004486mg [Citrus clementina] gi|557522697|gb|ESR34064.1| hypothetical protein CICLE_v10004486mg [Citrus clementina] Length = 667 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSLGPILSSSS+AEPY+THLAQ +LGVG D Sbjct: 635 ELQSLGPILSSSSQAEPYLTHLAQLVLGVGFD 666 >ref|XP_004162793.1| PREDICTED: LOW QUALITY PROTEIN: spindle pole body component 97-like [Cucumis sativus] Length = 478 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGV 330 ELQSLGPILS SS+AEPY+THLAQWILG+ Sbjct: 444 ELQSLGPILSKSSQAEPYLTHLAQWILGI 472 >ref|XP_004148270.1| PREDICTED: spindle pole body component 97-like [Cucumis sativus] Length = 707 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGV 330 ELQSLGPILS SS+AEPY+THLAQWILG+ Sbjct: 673 ELQSLGPILSKSSQAEPYLTHLAQWILGI 701 >gb|EPS65043.1| tubulin gamma complex-associated protein, partial [Genlisea aurea] Length = 547 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 EL+SLGPILSS S EPY+THLAQW+LGVG++ Sbjct: 516 ELRSLGPILSSGSHVEPYLTHLAQWLLGVGKN 547 >ref|XP_002529877.1| gamma-tubulin complex component, putative [Ricinus communis] gi|223530653|gb|EEF32527.1| gamma-tubulin complex component, putative [Ricinus communis] Length = 713 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 416 ELQSLGPILSSSSRAEPYVTHLAQWILGVGRD 321 ELQSLGPILS +S+AEPY+THLAQWILG+ D Sbjct: 681 ELQSLGPILSRNSQAEPYLTHLAQWILGIKSD 712