BLASTX nr result
ID: Mentha22_contig00030687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00030687 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19694.1| hypothetical protein MIMGU_mgv11b009143mg [Mimulu... 64 3e-08 >gb|EYU19694.1| hypothetical protein MIMGU_mgv11b009143mg [Mimulus guttatus] Length = 295 Score = 63.5 bits (153), Expect = 3e-08 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 2/60 (3%) Frame = -2 Query: 361 SEVHDKHSNKVLGTNKKKQS--DLTLENGTSSVILIKSIHNSKKNRPSISKSFPNLKQKR 188 SE+H+K S KV G KKK+S DL E+G +SVILIKSIH S KN SISKS+ KQK+ Sbjct: 235 SEIHEKASKKVGGILKKKRSRSDLNSEDGNASVILIKSIHTSNKNGTSISKSYLKSKQKK 294