BLASTX nr result
ID: Mentha22_contig00030588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00030588 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32244.1| hypothetical protein MIMGU_mgv1a000076mg [Mimulus... 61 1e-07 >gb|EYU32244.1| hypothetical protein MIMGU_mgv1a000076mg [Mimulus guttatus] Length = 1886 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/69 (46%), Positives = 45/69 (65%) Frame = -3 Query: 331 EDDAHYNRVLEEPEQPAPEKSASKVVNSENNQESNIQDSVTGSTAQLKNESEALHKKEEI 152 E+D HY++ EE A E+S S V+N+EN++E N+ D + S ++ E+EA KKE I Sbjct: 1452 ENDVHYDKESEEQHIEAKEESGSTVLNAENDKEVNVLDLIMASA--VRYENEASDKKEAI 1509 Query: 151 HSDTAKNHE 125 HSD AKN E Sbjct: 1510 HSDNAKNDE 1518