BLASTX nr result
ID: Mentha22_contig00029582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00029582 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34766.1| hypothetical protein MIMGU_mgv1a008504mg [Mimulus... 59 7e-07 >gb|EYU34766.1| hypothetical protein MIMGU_mgv1a008504mg [Mimulus guttatus] Length = 371 Score = 58.9 bits (141), Expect = 7e-07 Identities = 47/97 (48%), Positives = 54/97 (55%), Gaps = 29/97 (29%) Frame = +3 Query: 171 MNKKRRPGARKSRLSKAKKPKFLSLSRQFPPDE-----------MRP------AD----- 284 MN KRRP ARKSR+ KAKK KFLSL QFPP+E +RP AD Sbjct: 1 MNNKRRPKARKSRI-KAKKSKFLSLRLQFPPNESTIKDTKPDGGVRPKATASAADDDAAA 59 Query: 285 ----SRQLDLFPLHPDN---DRESQDQAENVALFFSA 374 S QL+ FP ++ +RE DQ ENVALFFSA Sbjct: 60 ANKYSPQLNSFPFDTESQVEEREGHDQ-ENVALFFSA 95