BLASTX nr result
ID: Mentha22_contig00029265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00029265 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437259.1| hypothetical protein CICLE_v10032349mg [Citr... 64 3e-08 ref|XP_007015531.1| NADH:cytochrome B5 reductase 1 [Theobroma ca... 62 8e-08 ref|XP_002319200.1| hypothetical protein POPTR_0013s06360g [Popu... 62 8e-08 ref|XP_003520929.1| PREDICTED: NADH--cytochrome b5 reductase 1 [... 62 1e-07 ref|XP_007204707.1| hypothetical protein PRUPE_ppa009801mg [Prun... 61 1e-07 gb|EYU30340.1| hypothetical protein MIMGU_mgv1a011487mg [Mimulus... 60 2e-07 ref|XP_003564467.1| PREDICTED: NADH-cytochrome b5 reductase 1-li... 60 2e-07 ref|XP_006288397.1| hypothetical protein CARUB_v10001654mg [Caps... 60 3e-07 ref|XP_004493245.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 60 4e-07 ref|XP_004144304.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 60 4e-07 ref|XP_003554059.1| PREDICTED: NADH--cytochrome b5 reductase 1 [... 60 4e-07 ref|XP_002527570.1| NADH-cytochrome B5 reductase, putative [Rici... 60 4e-07 gb|ACU19291.1| unknown [Glycine max] 59 5e-07 gb|AAV69020.1| NADH:cytochrome b5 reductase [Vernicia fordii] 59 5e-07 gb|EPS72506.1| hypothetical protein M569_02252, partial [Genlise... 59 7e-07 ref|XP_006339205.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 59 9e-07 ref|XP_004249368.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 59 9e-07 gb|EMT06434.1| NADH-cytochrome b5 reductase 1 [Aegilops tauschii] 58 1e-06 dbj|BAK02666.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 1e-06 ref|XP_004511163.1| PREDICTED: NADH--cytochrome b5 reductase 1-l... 58 2e-06 >ref|XP_006437259.1| hypothetical protein CICLE_v10032349mg [Citrus clementina] gi|568862667|ref|XP_006484798.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Citrus sinensis] gi|557539455|gb|ESR50499.1| hypothetical protein CICLE_v10032349mg [Citrus clementina] Length = 280 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 Q+LRCGPPPMNKAMAAHLEALGY SE LFQF Sbjct: 250 QVLRCGPPPMNKAMAAHLEALGYTSEMLFQF 280 >ref|XP_007015531.1| NADH:cytochrome B5 reductase 1 [Theobroma cacao] gi|508785894|gb|EOY33150.1| NADH:cytochrome B5 reductase 1 [Theobroma cacao] Length = 420 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMAAHLEALGY+SE FQF Sbjct: 390 QILRCGPPPMNKAMAAHLEALGYSSEMQFQF 420 >ref|XP_002319200.1| hypothetical protein POPTR_0013s06360g [Populus trichocarpa] gi|222857576|gb|EEE95123.1| hypothetical protein POPTR_0013s06360g [Populus trichocarpa] Length = 280 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 +ILRCGPPPMNKAMAAHLEALGYA E LFQF Sbjct: 250 KILRCGPPPMNKAMAAHLEALGYAPEMLFQF 280 >ref|XP_003520929.1| PREDICTED: NADH--cytochrome b5 reductase 1 [Glycine max] Length = 278 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 +ILRCGPPPMNKAMAAHLEALGYASE FQF Sbjct: 248 KILRCGPPPMNKAMAAHLEALGYASEMQFQF 278 >ref|XP_007204707.1| hypothetical protein PRUPE_ppa009801mg [Prunus persica] gi|462400238|gb|EMJ05906.1| hypothetical protein PRUPE_ppa009801mg [Prunus persica] Length = 277 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMAAHLEALGYA E FQF Sbjct: 247 QILRCGPPPMNKAMAAHLEALGYAPEMQFQF 277 >gb|EYU30340.1| hypothetical protein MIMGU_mgv1a011487mg [Mimulus guttatus] Length = 280 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMA HLEALGY+SE FQF Sbjct: 250 QILRCGPPPMNKAMAGHLEALGYSSEMQFQF 280 >ref|XP_003564467.1| PREDICTED: NADH-cytochrome b5 reductase 1-like [Brachypodium distachyon] Length = 279 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMAAHLEALGY +E FQF Sbjct: 249 QILRCGPPPMNKAMAAHLEALGYTNEMQFQF 279 >ref|XP_006288397.1| hypothetical protein CARUB_v10001654mg [Capsella rubella] gi|482557103|gb|EOA21295.1| hypothetical protein CARUB_v10001654mg [Capsella rubella] Length = 281 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMAA+LEALGY+ E LFQF Sbjct: 251 QILRCGPPPMNKAMAANLEALGYSQEMLFQF 281 >ref|XP_004493245.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Cicer arietinum] Length = 278 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 +ILRCGPPPMNKAMAAHLEALGYA E FQF Sbjct: 248 KILRCGPPPMNKAMAAHLEALGYAPEMQFQF 278 >ref|XP_004144304.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Cucumis sativus] gi|449488287|ref|XP_004157991.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Cucumis sativus] Length = 281 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMAAHLE LGYA E LF F Sbjct: 251 QILRCGPPPMNKAMAAHLEELGYAPEMLFMF 281 >ref|XP_003554059.1| PREDICTED: NADH--cytochrome b5 reductase 1 [Glycine max] Length = 278 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 +ILRCGPPPMNKAMAAHLEALGYA E FQF Sbjct: 248 KILRCGPPPMNKAMAAHLEALGYAPEMQFQF 278 >ref|XP_002527570.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] gi|223533062|gb|EEF34822.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] Length = 279 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMAAHL ALGY SE FQF Sbjct: 249 QILRCGPPPMNKAMAAHLNALGYTSEMQFQF 279 >gb|ACU19291.1| unknown [Glycine max] Length = 278 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 +ILRCGPPPMNKAMAAHLEALGYA E FQF Sbjct: 248 KILRCGPPPMNKAMAAHLEALGYAFEMQFQF 278 >gb|AAV69020.1| NADH:cytochrome b5 reductase [Vernicia fordii] Length = 279 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMAAHL+ALGY S+ FQF Sbjct: 249 QILRCGPPPMNKAMAAHLDALGYTSQMQFQF 279 >gb|EPS72506.1| hypothetical protein M569_02252, partial [Genlisea aurea] Length = 194 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMA HL+ALGY SE FQF Sbjct: 164 QILRCGPPPMNKAMAGHLDALGYTSEMQFQF 194 >ref|XP_006339205.1| PREDICTED: NADH--cytochrome b5 reductase 1-like isoform X1 [Solanum tuberosum] gi|565344202|ref|XP_006339206.1| PREDICTED: NADH--cytochrome b5 reductase 1-like isoform X2 [Solanum tuberosum] Length = 278 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 +ILRCGPPPMNKAMAAHLEALGY+ E FQF Sbjct: 248 KILRCGPPPMNKAMAAHLEALGYSPEMQFQF 278 >ref|XP_004249368.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Solanum lycopersicum] Length = 278 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 +ILRCGPPPMNKAMAAHLEALGY+ E FQF Sbjct: 248 KILRCGPPPMNKAMAAHLEALGYSPEMQFQF 278 >gb|EMT06434.1| NADH-cytochrome b5 reductase 1 [Aegilops tauschii] Length = 268 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMAAHLE LGY E FQF Sbjct: 238 QILRCGPPPMNKAMAAHLEELGYTKEMQFQF 268 >dbj|BAK02666.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 279 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMAAHLE LGY E FQF Sbjct: 249 QILRCGPPPMNKAMAAHLEELGYTKEMQFQF 279 >ref|XP_004511163.1| PREDICTED: NADH--cytochrome b5 reductase 1-like [Cicer arietinum] Length = 296 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +3 Query: 3 QILRCGPPPMNKAMAAHLEALGYASETLFQF 95 QILRCGPPPMNKAMA HLEALGY S FQF Sbjct: 266 QILRCGPPPMNKAMAIHLEALGYTSNMQFQF 296