BLASTX nr result
ID: Mentha22_contig00029184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00029184 (356 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27768.1| hypothetical protein MIMGU_mgv1a011558mg [Mimulus... 75 1e-11 >gb|EYU27768.1| hypothetical protein MIMGU_mgv1a011558mg [Mimulus guttatus] Length = 277 Score = 75.1 bits (183), Expect = 1e-11 Identities = 39/84 (46%), Positives = 50/84 (59%), Gaps = 15/84 (17%) Frame = -2 Query: 208 MLTVHITGAFNSCQAYMELNLLQEATHSKFMHINPLIHTSNSTIPSKVIFHKGWSS---- 41 MLTVH GAF+SC + N+LQ+ T++K MH+N L+ +ST P K +KGWSS Sbjct: 1 MLTVHNQGAFSSCLTHTIKNMLQDTTNAKLMHVNSLLRIVDSTGPVKFQCNKGWSSWFFS 60 Query: 40 -----------FSHQIASRRWLCR 2 FSHQI S+RWLCR Sbjct: 61 PNYTNQLKLQRFSHQITSKRWLCR 84