BLASTX nr result
ID: Mentha22_contig00029183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00029183 (423 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27768.1| hypothetical protein MIMGU_mgv1a011558mg [Mimulus... 70 3e-10 >gb|EYU27768.1| hypothetical protein MIMGU_mgv1a011558mg [Mimulus guttatus] Length = 277 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/83 (44%), Positives = 49/83 (59%), Gaps = 15/83 (18%) Frame = +2 Query: 218 MLTVHIPGAFNSCQAYMEFNLLQEATHSKFMHINPLIHTPNSTIPSKVIFHKGWSS---- 385 MLTVH GAF+SC + N+LQ+ T++K MH+N L+ +ST P K +KGWSS Sbjct: 1 MLTVHNQGAFSSCLTHTIKNMLQDTTNAKLMHVNSLLRIVDSTGPVKFQCNKGWSSWFFS 60 Query: 386 -----------FSNQIASRRWLC 421 FS+QI S+RWLC Sbjct: 61 PNYTNQLKLQRFSHQITSKRWLC 83