BLASTX nr result
ID: Mentha22_contig00029005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00029005 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19774.1| hypothetical protein MIMGU_mgv1a001675mg [Mimulus... 67 3e-09 ref|XP_004249969.1| PREDICTED: uncharacterized protein LOC101268... 57 2e-06 ref|XP_006858919.1| hypothetical protein AMTR_s00068p00051520 [A... 56 6e-06 >gb|EYU19774.1| hypothetical protein MIMGU_mgv1a001675mg [Mimulus guttatus] Length = 774 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/40 (75%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +1 Query: 181 THV-EEALCLLCTLINLFPSSVHRHYDGVEAAIVSKLISG 297 +HV EEA+CL+CT+IN FPS+VHRHYD VEAAIVSK++SG Sbjct: 122 SHVQEEAVCLICTMINFFPSTVHRHYDSVEAAIVSKIVSG 161 >ref|XP_004249969.1| PREDICTED: uncharacterized protein LOC101268822 [Solanum lycopersicum] Length = 852 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +1 Query: 190 EEALCLLCTLINLFPSSVHRHYDGVEAAIVSKLISG 297 EEA+ LLC+++++FPSS+ RHYDGVE AIVS+L+SG Sbjct: 186 EEAIFLLCSILDIFPSSIQRHYDGVEEAIVSRLLSG 221 >ref|XP_006858919.1| hypothetical protein AMTR_s00068p00051520 [Amborella trichopoda] gi|548863031|gb|ERN20386.1| hypothetical protein AMTR_s00068p00051520 [Amborella trichopoda] Length = 859 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/51 (52%), Positives = 32/51 (62%), Gaps = 5/51 (9%) Frame = +1 Query: 160 PVTTIARTHVEEALC-----LLCTLINLFPSSVHRHYDGVEAAIVSKLISG 297 P+ + E +C LLCTLI FPSS+H HYD VEAAI SK+ISG Sbjct: 171 PILQLLSEDCSETVCEGVVDLLCTLITFFPSSIHHHYDNVEAAIASKIISG 221