BLASTX nr result
ID: Mentha22_contig00028994
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00028994 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28182.1| hypothetical protein MIMGU_mgv1a000652mg [Mimulus... 56 4e-06 >gb|EYU28182.1| hypothetical protein MIMGU_mgv1a000652mg [Mimulus guttatus] Length = 1031 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/49 (61%), Positives = 32/49 (65%) Frame = -1 Query: 149 MESAPSTCFLRRGLVGAGLKPAQVPVRLYSSSWQRWYPTSCRIRQRNFS 3 ME+ PST RGLV GLK QV VR Y S QR +P SCRIR RNFS Sbjct: 1 MEATPSTWLRGRGLVVGGLKFGQVIVRFYPSPSQRLHPASCRIRHRNFS 49