BLASTX nr result
ID: Mentha22_contig00028690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00028690 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31174.1| hypothetical protein MIMGU_mgv1a014356mg [Mimulus... 76 6e-12 >gb|EYU31174.1| hypothetical protein MIMGU_mgv1a014356mg [Mimulus guttatus] Length = 192 Score = 75.9 bits (185), Expect = 6e-12 Identities = 37/68 (54%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Frame = +3 Query: 207 MRHYFTRFISQSLTRFPKSIT-PTPRIETPLKSPNLIRRFTATAEESESAPPDRVNEIVN 383 MRH+++R ISQ+L R K IT P P+IETPL++PNLIR F+A+A+ES+ A +RV+ I Sbjct: 1 MRHHYSRLISQTLPRLRKPITTPNPQIETPLRNPNLIRNFSASAQESKPATSERVSGIAE 60 Query: 384 ELCGLSIL 407 E+ GL++L Sbjct: 61 EISGLTLL 68