BLASTX nr result
ID: Mentha22_contig00028625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00028625 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343649.1| PREDICTED: probable cyclic nucleotide-gated ... 92 7e-17 ref|XP_004242592.1| PREDICTED: probable cyclic nucleotide-gated ... 92 7e-17 ref|XP_006474002.1| PREDICTED: probable cyclic nucleotide-gated ... 92 1e-16 ref|XP_006453609.1| hypothetical protein CICLE_v10007576mg [Citr... 92 1e-16 gb|EYU34343.1| hypothetical protein MIMGU_mgv1a001946mg [Mimulus... 91 1e-16 ref|XP_002325129.2| cyclic nucleotide-gated ion channel 5 family... 91 2e-16 gb|EPS68056.1| hypothetical protein M569_06716 [Genlisea aurea] 91 2e-16 ref|XP_007011918.1| Cyclic nucleotide gated channel 5 isoform 2,... 89 6e-16 ref|XP_007011917.1| Cyclic nucleotide gated channel 5 isoform 1 ... 89 6e-16 ref|XP_002529385.1| Cyclic nucleotide-gated ion channel, putativ... 89 6e-16 ref|XP_007204256.1| hypothetical protein PRUPE_ppa001993mg [Prun... 88 1e-15 ref|XP_004251749.1| PREDICTED: probable cyclic nucleotide-gated ... 88 1e-15 ref|XP_003540100.1| PREDICTED: probable cyclic nucleotide-gated ... 88 1e-15 ref|XP_006350103.1| PREDICTED: probable cyclic nucleotide-gated ... 86 4e-15 ref|XP_002278464.1| PREDICTED: probable cyclic nucleotide-gated ... 83 4e-14 ref|XP_004287136.1| PREDICTED: probable cyclic nucleotide-gated ... 79 5e-13 ref|XP_004168115.1| PREDICTED: probable cyclic nucleotide-gated ... 79 5e-13 ref|XP_004144729.1| PREDICTED: probable cyclic nucleotide-gated ... 79 5e-13 ref|NP_851209.1| cyclic nucleotide gated channel 5 [Arabidopsis ... 79 6e-13 ref|NP_974953.1| cyclic nucleotide gated channel 5 [Arabidopsis ... 79 6e-13 >ref|XP_006343649.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X1 [Solanum tuberosum] gi|565353461|ref|XP_006343650.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X2 [Solanum tuberosum] Length = 735 Score = 92.0 bits (227), Expect = 7e-17 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTADAD 149 +YSI ATFLA+KFAANA+RGVHRNRNLKSARELVKLQKPPEPDF+ADAD Sbjct: 687 TYSIRATFLASKFAANALRGVHRNRNLKSARELVKLQKPPEPDFSADAD 735 >ref|XP_004242592.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like [Solanum lycopersicum] Length = 735 Score = 92.0 bits (227), Expect = 7e-17 Identities = 44/49 (89%), Positives = 48/49 (97%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTADAD 149 +YSI ATFLA+KFAANA+RGVHRNRNLKSARELVKLQKPPEPDF+ADAD Sbjct: 687 TYSIRATFLASKFAANALRGVHRNRNLKSARELVKLQKPPEPDFSADAD 735 >ref|XP_006474002.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X1 [Citrus sinensis] gi|568840088|ref|XP_006474003.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X2 [Citrus sinensis] gi|568840090|ref|XP_006474004.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X3 [Citrus sinensis] gi|568840092|ref|XP_006474005.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X4 [Citrus sinensis] gi|568840094|ref|XP_006474006.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X5 [Citrus sinensis] Length = 733 Score = 91.7 bits (226), Expect = 1e-16 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 1/50 (2%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTA-DAD 149 SYSIGATFLAT+FAANA+RGVHRNRN KSARELVKLQKPPEPDFTA DAD Sbjct: 684 SYSIGATFLATRFAANALRGVHRNRNAKSARELVKLQKPPEPDFTAEDAD 733 >ref|XP_006453609.1| hypothetical protein CICLE_v10007576mg [Citrus clementina] gi|557556835|gb|ESR66849.1| hypothetical protein CICLE_v10007576mg [Citrus clementina] Length = 735 Score = 91.7 bits (226), Expect = 1e-16 Identities = 46/50 (92%), Positives = 48/50 (96%), Gaps = 1/50 (2%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTA-DAD 149 SYSIGATFLAT+FAANA+RGVHRNRN KSARELVKLQKPPEPDFTA DAD Sbjct: 686 SYSIGATFLATRFAANALRGVHRNRNAKSARELVKLQKPPEPDFTAEDAD 735 >gb|EYU34343.1| hypothetical protein MIMGU_mgv1a001946mg [Mimulus guttatus] Length = 735 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTADAD 149 SYSIGATFL ++FAANA+RGVHRNRNLK RELVKLQKPPEPDFTADAD Sbjct: 687 SYSIGATFLVSRFAANALRGVHRNRNLKITRELVKLQKPPEPDFTADAD 735 >ref|XP_002325129.2| cyclic nucleotide-gated ion channel 5 family protein [Populus trichocarpa] gi|550318518|gb|EEF03694.2| cyclic nucleotide-gated ion channel 5 family protein [Populus trichocarpa] Length = 734 Score = 90.9 bits (224), Expect = 2e-16 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTAD 143 SYSIGATFLAT+FAANA+RG+HRNRN K+ARELVKLQKPPEPDFTAD Sbjct: 685 SYSIGATFLATRFAANALRGIHRNRNAKTARELVKLQKPPEPDFTAD 731 >gb|EPS68056.1| hypothetical protein M569_06716 [Genlisea aurea] Length = 728 Score = 90.5 bits (223), Expect = 2e-16 Identities = 45/50 (90%), Positives = 49/50 (98%), Gaps = 1/50 (2%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNL-KSARELVKLQKPPEPDFTADAD 149 SYSIGATFLA+KFAANA+RGVHRNRNL KSA+ELVKLQKPPEPDF+ADAD Sbjct: 679 SYSIGATFLASKFAANALRGVHRNRNLKKSAKELVKLQKPPEPDFSADAD 728 >ref|XP_007011918.1| Cyclic nucleotide gated channel 5 isoform 2, partial [Theobroma cacao] gi|508782281|gb|EOY29537.1| Cyclic nucleotide gated channel 5 isoform 2, partial [Theobroma cacao] Length = 634 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 1/50 (2%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTA-DAD 149 SYS+GATFLA+KFAANA+RG+HRNRN KSA+ELVKLQKPPEPDFTA DAD Sbjct: 585 SYSLGATFLASKFAANALRGIHRNRNAKSAKELVKLQKPPEPDFTAEDAD 634 >ref|XP_007011917.1| Cyclic nucleotide gated channel 5 isoform 1 [Theobroma cacao] gi|508782280|gb|EOY29536.1| Cyclic nucleotide gated channel 5 isoform 1 [Theobroma cacao] Length = 739 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/50 (86%), Positives = 48/50 (96%), Gaps = 1/50 (2%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTA-DAD 149 SYS+GATFLA+KFAANA+RG+HRNRN KSA+ELVKLQKPPEPDFTA DAD Sbjct: 690 SYSLGATFLASKFAANALRGIHRNRNAKSAKELVKLQKPPEPDFTAEDAD 739 >ref|XP_002529385.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] gi|223531133|gb|EEF32981.1| Cyclic nucleotide-gated ion channel, putative [Ricinus communis] Length = 735 Score = 89.0 bits (219), Expect = 6e-16 Identities = 44/50 (88%), Positives = 48/50 (96%), Gaps = 1/50 (2%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTA-DAD 149 SYSIGATFLAT+FAANA+RGVHRNRN K+ARELVKLQKPPEPDF+A DAD Sbjct: 686 SYSIGATFLATRFAANALRGVHRNRNAKTARELVKLQKPPEPDFSAEDAD 735 >ref|XP_007204256.1| hypothetical protein PRUPE_ppa001993mg [Prunus persica] gi|462399787|gb|EMJ05455.1| hypothetical protein PRUPE_ppa001993mg [Prunus persica] Length = 732 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/48 (85%), Positives = 47/48 (97%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTADA 146 SYSIGATFLA++FAANA+RGVHRNRN KSARELVKLQKPPEPDF+A++ Sbjct: 683 SYSIGATFLASRFAANALRGVHRNRNAKSARELVKLQKPPEPDFSAES 730 >ref|XP_004251749.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform 1 [Solanum lycopersicum] gi|460412729|ref|XP_004251750.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform 2 [Solanum lycopersicum] Length = 692 Score = 87.8 bits (216), Expect = 1e-15 Identities = 40/49 (81%), Positives = 47/49 (95%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTADAD 149 S+SIGATFLA++FAANA+RGVH+NRNLKSAREL+KLQKPPEPDF+ D D Sbjct: 644 SFSIGATFLASRFAANALRGVHKNRNLKSARELMKLQKPPEPDFSEDTD 692 >ref|XP_003540100.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X1 [Glycine max] gi|571493594|ref|XP_006592597.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X2 [Glycine max] Length = 732 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTAD 143 SYS+GATFLA++FAANA+RGVHRNR KSARELVKLQKPPEPDFTAD Sbjct: 683 SYSLGATFLASRFAANALRGVHRNREAKSARELVKLQKPPEPDFTAD 729 >ref|XP_006350103.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X1 [Solanum tuberosum] gi|565366869|ref|XP_006350104.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X2 [Solanum tuberosum] gi|565366871|ref|XP_006350105.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like isoform X3 [Solanum tuberosum] Length = 692 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/49 (79%), Positives = 47/49 (95%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTADAD 149 S+SIGATFLA++FAANA+RGVH+NRNLKSAREL+KLQKPPEPDF+ D + Sbjct: 644 SFSIGATFLASRFAANALRGVHKNRNLKSARELMKLQKPPEPDFSEDTE 692 >ref|XP_002278464.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5 [Vitis vinifera] gi|297743648|emb|CBI36531.3| unnamed protein product [Vitis vinifera] Length = 743 Score = 82.8 bits (203), Expect = 4e-14 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTAD 143 SYS+GAT LA++FAANA+RGVHRNR KSARELVKLQKPPEPDF+AD Sbjct: 694 SYSLGATILASRFAANALRGVHRNRITKSARELVKLQKPPEPDFSAD 740 >ref|XP_004287136.1| PREDICTED: probable cyclic nucleotide-gated ion channel 5-like [Fragaria vesca subsp. vesca] Length = 732 Score = 79.3 bits (194), Expect = 5e-13 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 4/51 (7%) Frame = +3 Query: 9 SIGATFLATKFAANAMRGVHRNRNLK---SARELVKLQKPPEPDFTA-DAD 149 SIGATFLAT+FAANA+RGVHRNRN K SAR+LVKLQKPPEPDF+A DAD Sbjct: 682 SIGATFLATRFAANALRGVHRNRNAKIAQSARDLVKLQKPPEPDFSAEDAD 732 >ref|XP_004168115.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6-like, partial [Cucumis sativus] Length = 711 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTAD 143 SYSI ATFLA+KFAANA+RGV R RN KSA+EL+KLQKPPEPDF+AD Sbjct: 662 SYSIRATFLASKFAANALRGVQRYRNAKSAQELIKLQKPPEPDFSAD 708 >ref|XP_004144729.1| PREDICTED: probable cyclic nucleotide-gated ion channel 6-like [Cucumis sativus] Length = 731 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTAD 143 SYSI ATFLA+KFAANA+RGV R RN KSA+EL+KLQKPPEPDF+AD Sbjct: 682 SYSIRATFLASKFAANALRGVQRYRNAKSAQELIKLQKPPEPDFSAD 728 >ref|NP_851209.1| cyclic nucleotide gated channel 5 [Arabidopsis thaliana] gi|42568613|ref|NP_200602.2| cyclic nucleotide gated channel 5 [Arabidopsis thaliana] gi|38503077|sp|Q8RWS9.1|CNGC5_ARATH RecName: Full=Probable cyclic nucleotide-gated ion channel 5; Short=AtCNGC5; AltName: Full=Cyclic nucleotide- and calmodulin-regulated ion channel 5 gi|20268758|gb|AAM14082.1| putative cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis thaliana] gi|21281123|gb|AAM45101.1| putative cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis thaliana] gi|222423973|dbj|BAH19948.1| AT5G57940 [Arabidopsis thaliana] gi|332009591|gb|AED96974.1| cyclic nucleotide gated channel 5 [Arabidopsis thaliana] gi|332009593|gb|AED96976.1| cyclic nucleotide gated channel 5 [Arabidopsis thaliana] Length = 717 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTAD 143 SYSIGA FLATKFAANA+R +HRNRN K R+LVKLQKPPEPDFTAD Sbjct: 672 SYSIGAAFLATKFAANALRTIHRNRNTK-IRDLVKLQKPPEPDFTAD 717 >ref|NP_974953.1| cyclic nucleotide gated channel 5 [Arabidopsis thaliana] gi|4581205|emb|CAB40130.1| cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis thaliana] gi|9758363|dbj|BAB08864.1| cyclic nucleotide and calmodulin-regulated ion channel [Arabidopsis thaliana] gi|332009592|gb|AED96975.1| cyclic nucleotide gated channel 5 [Arabidopsis thaliana] Length = 710 Score = 79.0 bits (193), Expect = 6e-13 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +3 Query: 3 SYSIGATFLATKFAANAMRGVHRNRNLKSARELVKLQKPPEPDFTAD 143 SYSIGA FLATKFAANA+R +HRNRN K R+LVKLQKPPEPDFTAD Sbjct: 665 SYSIGAAFLATKFAANALRTIHRNRNTK-IRDLVKLQKPPEPDFTAD 710