BLASTX nr result
ID: Mentha22_contig00028624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00028624 (810 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71621.1| hypothetical protein VITISV_016299 [Vitis vinifera] 80 7e-13 ref|XP_003631201.1| PREDICTED: cysteine-rich receptor-like prote... 80 9e-13 ref|XP_004236943.1| PREDICTED: cysteine-rich receptor-like prote... 78 3e-12 ref|XP_004236942.1| PREDICTED: cysteine-rich receptor-like prote... 78 3e-12 ref|XP_006355074.1| PREDICTED: cysteine-rich receptor-like prote... 78 4e-12 ref|XP_002315871.2| kinase family protein [Populus trichocarpa] ... 78 4e-12 ref|XP_004297467.1| PREDICTED: cysteine-rich receptor-like prote... 77 1e-11 ref|XP_002311515.2| hypothetical protein POPTR_0008s13160g [Popu... 76 1e-11 ref|XP_007045211.1| Cysteine-rich receptor-like protein kinase 1... 76 1e-11 ref|XP_006469213.1| PREDICTED: cysteine-rich receptor-like prote... 76 2e-11 ref|XP_007158801.1| hypothetical protein PHAVU_002G182900g [Phas... 76 2e-11 ref|XP_006448211.1| hypothetical protein CICLE_v10015463mg [Citr... 76 2e-11 ref|XP_004504575.1| PREDICTED: putative cysteine-rich receptor-l... 76 2e-11 ref|XP_004142276.1| PREDICTED: cysteine-rich receptor-like prote... 75 2e-11 ref|XP_003532692.1| PREDICTED: cysteine-rich receptor-like prote... 75 3e-11 ref|XP_002527785.1| Serine/threonine-protein kinase PBS1, putati... 75 3e-11 gb|EXB90894.1| Cysteine-rich receptor-like protein kinase 10 [Mo... 75 4e-11 ref|XP_007223006.1| hypothetical protein PRUPE_ppa006805mg [Prun... 75 4e-11 ref|XP_004504576.1| PREDICTED: putative cysteine-rich receptor-l... 74 5e-11 ref|XP_003524143.1| PREDICTED: cysteine-rich receptor-like prote... 74 5e-11 >emb|CAN71621.1| hypothetical protein VITISV_016299 [Vitis vinifera] Length = 437 Score = 80.5 bits (197), Expect = 7e-13 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLFS 674 NEAKLL+RVQH+NVVNLLGYC R AEKLLVYEY++N+SLDK+LF+ Sbjct: 103 NEAKLLARVQHRNVVNLLGYCTRGAEKLLVYEYISNESLDKFLFN 147 >ref|XP_003631201.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Vitis vinifera] gi|297737665|emb|CBI26866.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 80.1 bits (196), Expect = 9e-13 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNLLGYC R AEKLLVYEY++N+SLDK+LF Sbjct: 103 NEAKLLARVQHRNVVNLLGYCTRGAEKLLVYEYISNESLDKFLF 146 >ref|XP_004236943.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like isoform 2 [Solanum lycopersicum] Length = 339 Score = 78.2 bits (191), Expect = 3e-12 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNLLGYCV EKLLVYEYVAN+SLDK LF Sbjct: 34 NEAKLLARVQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKILF 77 >ref|XP_004236942.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like isoform 1 [Solanum lycopersicum] Length = 399 Score = 78.2 bits (191), Expect = 3e-12 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNLLGYCV EKLLVYEYVAN+SLDK LF Sbjct: 94 NEAKLLARVQHRNVVNLLGYCVHGVEKLLVYEYVANESLDKILF 137 >ref|XP_006355074.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Solanum tuberosum] Length = 398 Score = 77.8 bits (190), Expect = 4e-12 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNLLGYC+ EKLLVYEYVAN+SLDK LF Sbjct: 93 NEAKLLARVQHRNVVNLLGYCIHGVEKLLVYEYVANESLDKILF 136 >ref|XP_002315871.2| kinase family protein [Populus trichocarpa] gi|550329616|gb|EEF02042.2| kinase family protein [Populus trichocarpa] Length = 404 Score = 77.8 bits (190), Expect = 4e-12 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLLSRVQH+NVVNLLGYC EKLLVYEYVAN+SLDK LF Sbjct: 95 NEAKLLSRVQHRNVVNLLGYCAHGVEKLLVYEYVANESLDKLLF 138 >ref|XP_004297467.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Fragaria vesca subsp. vesca] Length = 428 Score = 76.6 bits (187), Expect = 1e-11 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNLLGYCV EKLLVYEYV N+SLDK LF Sbjct: 95 NEAKLLARVQHRNVVNLLGYCVHGVEKLLVYEYVVNESLDKLLF 138 >ref|XP_002311515.2| hypothetical protein POPTR_0008s13160g [Populus trichocarpa] gi|550332964|gb|EEE88882.2| hypothetical protein POPTR_0008s13160g [Populus trichocarpa] Length = 393 Score = 76.3 bits (186), Expect = 1e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+N+VNLLGYC EKLLVYEYVAN+SLDK LF Sbjct: 95 NEAKLLARVQHRNIVNLLGYCAHGVEKLLVYEYVANESLDKLLF 138 >ref|XP_007045211.1| Cysteine-rich receptor-like protein kinase 10 [Theobroma cacao] gi|508709146|gb|EOY01043.1| Cysteine-rich receptor-like protein kinase 10 [Theobroma cacao] Length = 404 Score = 76.3 bits (186), Expect = 1e-11 Identities = 36/44 (81%), Positives = 38/44 (86%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLLSRVQH+NVVNLLGYC EKLLVYEYV N+SLDK LF Sbjct: 97 NEAKLLSRVQHRNVVNLLGYCAHGTEKLLVYEYVTNESLDKLLF 140 >ref|XP_006469213.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Citrus sinensis] Length = 404 Score = 75.9 bits (185), Expect = 2e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNLLGYC AEKLL+YEYV N+SLDK LF Sbjct: 95 NEAKLLARVQHRNVVNLLGYCAHGAEKLLIYEYVINESLDKVLF 138 >ref|XP_007158801.1| hypothetical protein PHAVU_002G182900g [Phaseolus vulgaris] gi|561032216|gb|ESW30795.1| hypothetical protein PHAVU_002G182900g [Phaseolus vulgaris] Length = 406 Score = 75.9 bits (185), Expect = 2e-11 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNL+GYCV EKLLVYEYVA++SLDK+LF Sbjct: 101 NEAKLLARVQHRNVVNLVGYCVHGNEKLLVYEYVAHESLDKFLF 144 >ref|XP_006448211.1| hypothetical protein CICLE_v10015463mg [Citrus clementina] gi|557550822|gb|ESR61451.1| hypothetical protein CICLE_v10015463mg [Citrus clementina] Length = 404 Score = 75.9 bits (185), Expect = 2e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNLLGYC AEKLL+YEYV N+SLDK LF Sbjct: 95 NEAKLLARVQHRNVVNLLGYCAHGAEKLLIYEYVINESLDKVLF 138 >ref|XP_004504575.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 35-like isoform X1 [Cicer arietinum] Length = 402 Score = 75.9 bits (185), Expect = 2e-11 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLFS 674 NEAKLL+RVQH+NVVNLLGYCV EKLLVYEYV ++SLDK LFS Sbjct: 95 NEAKLLARVQHRNVVNLLGYCVHGTEKLLVYEYVPHESLDKLLFS 139 >ref|XP_004142276.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Cucumis sativus] gi|449527341|ref|XP_004170670.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Cucumis sativus] Length = 412 Score = 75.5 bits (184), Expect = 2e-11 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -3 Query: 805 EAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 EAKLL+RVQH+NVVNLLGYCV AEKLLVYEYV N+SLDK LF Sbjct: 96 EAKLLARVQHRNVVNLLGYCVHGAEKLLVYEYVMNESLDKLLF 138 >ref|XP_003532692.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Glycine max] Length = 405 Score = 75.1 bits (183), Expect = 3e-11 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNL+GYCV EKLLVYEYVA++SLDK LF Sbjct: 99 NEAKLLARVQHRNVVNLVGYCVHGTEKLLVYEYVAHESLDKLLF 142 >ref|XP_002527785.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] gi|223532820|gb|EEF34595.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] Length = 411 Score = 75.1 bits (183), Expect = 3e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNLLGYC EKLLVYEYV+N+SLDK LF Sbjct: 95 NEAKLLARVQHRNVVNLLGYCTHGMEKLLVYEYVSNESLDKLLF 138 >gb|EXB90894.1| Cysteine-rich receptor-like protein kinase 10 [Morus notabilis] Length = 413 Score = 74.7 bits (182), Expect = 4e-11 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNLLGYCV +EKLLVYEYV ++SLDK LF Sbjct: 96 NEAKLLARVQHRNVVNLLGYCVHGSEKLLVYEYVPHESLDKLLF 139 >ref|XP_007223006.1| hypothetical protein PRUPE_ppa006805mg [Prunus persica] gi|462419942|gb|EMJ24205.1| hypothetical protein PRUPE_ppa006805mg [Prunus persica] Length = 394 Score = 74.7 bits (182), Expect = 4e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNLLGYC EKLLVYEYVA++SLDK LF Sbjct: 95 NEAKLLARVQHRNVVNLLGYCAHGVEKLLVYEYVAHESLDKLLF 138 >ref|XP_004504576.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 35-like isoform X2 [Cicer arietinum] Length = 397 Score = 74.3 bits (181), Expect = 5e-11 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNLLGYCV EKLLVYEYV ++SLDK LF Sbjct: 95 NEAKLLARVQHRNVVNLLGYCVHGTEKLLVYEYVPHESLDKLLF 138 >ref|XP_003524143.1| PREDICTED: cysteine-rich receptor-like protein kinase 10-like [Glycine max] Length = 400 Score = 74.3 bits (181), Expect = 5e-11 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -3 Query: 808 NEAKLLSRVQHKNVVNLLGYCVRDAEKLLVYEYVANQSLDKYLF 677 NEAKLL+RVQH+NVVNL+GYCV EKLLVYEYVA++SLDK LF Sbjct: 99 NEAKLLARVQHRNVVNLVGYCVYGTEKLLVYEYVAHESLDKLLF 142