BLASTX nr result
ID: Mentha22_contig00028620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00028620 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20387.1| hypothetical protein MIMGU_mgv1a004114mg [Mimulus... 73 5e-11 ref|XP_007222298.1| hypothetical protein PRUPE_ppa003357mg [Prun... 55 8e-06 >gb|EYU20387.1| hypothetical protein MIMGU_mgv1a004114mg [Mimulus guttatus] Length = 543 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -3 Query: 331 GIVGGLTDLSQEKDKGPLPSFYMGTPMGSVSMHGKSGFTSTPLNDD 194 GIVGGLTD S+EKDKG LPSFYMG MG+ + GKSGFTSTPL+DD Sbjct: 481 GIVGGLTDGSEEKDKGHLPSFYMGKAMGAGTAGGKSGFTSTPLDDD 526 >ref|XP_007222298.1| hypothetical protein PRUPE_ppa003357mg [Prunus persica] gi|462419234|gb|EMJ23497.1| hypothetical protein PRUPE_ppa003357mg [Prunus persica] Length = 582 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -3 Query: 331 GIVGGLTDLSQEKDKGPLPSFYMGTPMGSVSMHGKSGFTSTP 206 GIVGGLTD S E++KGP S+YMG MGS + GKSGF S+P Sbjct: 515 GIVGGLTDGSDEREKGPPTSYYMGRAMGSGTGLGKSGFPSSP 556