BLASTX nr result
ID: Mentha22_contig00028293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00028293 (575 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35090.1| hypothetical protein MIMGU_mgv1a008557mg [Mimulus... 63 5e-08 >gb|EYU35090.1| hypothetical protein MIMGU_mgv1a008557mg [Mimulus guttatus] Length = 369 Score = 63.2 bits (152), Expect = 5e-08 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 6/43 (13%) Frame = -3 Query: 111 MDYRRENGFSNGNVVQVLSGN------ENWGLESSDQAIWATE 1 MDY RENGFS+GNVVQ+L+GN ENWG S+DQA+WATE Sbjct: 1 MDYNRENGFSSGNVVQILTGNSVNNVDENWGSASNDQAVWATE 43