BLASTX nr result
ID: Mentha22_contig00028265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00028265 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21218.1| hypothetical protein MIMGU_mgv1a003772mg [Mimulus... 62 1e-07 gb|EXC44894.1| Mannosyl-oligosaccharide 1,2-alpha-mannosidase MN... 56 6e-06 >gb|EYU21218.1| hypothetical protein MIMGU_mgv1a003772mg [Mimulus guttatus] Length = 565 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = -3 Query: 410 DEWVFNTEAHPIKIVPRHDHMGKLGVSESEH-LETRSRARREGRFHD 273 DEWVFNTEAHPIKI+ RHD GK S +H +ETRSRAR+EGR D Sbjct: 521 DEWVFNTEAHPIKIMTRHDLAGK---SVGKHIIETRSRARKEGRLPD 564 >gb|EXC44894.1| Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 [Morus notabilis] Length = 593 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/46 (54%), Positives = 30/46 (65%) Frame = -3 Query: 410 DEWVFNTEAHPIKIVPRHDHMGKLGVSESEHLETRSRARREGRFHD 273 DEWVFNTEAHPI+IVPRHD + E + + R R+EGR D Sbjct: 548 DEWVFNTEAHPIRIVPRHDGVDFENTGEKQKPNLKLRGRKEGRSRD 593