BLASTX nr result
ID: Mentha22_contig00028010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00028010 (570 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC28019.1| Cell division protein FtsY-like protein [Morus no... 119 6e-25 ref|XP_002511808.1| cell division protein ftsy, putative [Ricinu... 117 2e-24 ref|XP_006445129.1| hypothetical protein CICLE_v10020663mg [Citr... 116 4e-24 gb|EPS70118.1| hypothetical protein M569_04639, partial [Genlise... 115 6e-24 ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolo... 115 6e-24 ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phas... 115 1e-23 ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolo... 115 1e-23 ref|XP_004510851.1| PREDICTED: cell division protein FtsY homolo... 114 1e-23 ref|XP_003627628.1| Signal recognition 54 kDa protein [Medicago ... 114 1e-23 gb|EMT07986.1| Cell division ftsY-like protein [Aegilops tauschii] 114 2e-23 gb|EMS57234.1| Cell division protein ftsY-like protein [Triticum... 114 2e-23 dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgar... 114 2e-23 ref|XP_007051904.1| Signal recognition particle receptor protein... 114 2e-23 ref|XP_007051903.1| Signal recognition particle receptor protein... 114 2e-23 ref|XP_003565107.1| PREDICTED: cell division protein ftsY homolo... 114 2e-23 ref|XP_006857853.1| hypothetical protein AMTR_s00069p00071970 [A... 113 3e-23 ref|XP_002320775.1| signal recognition particle receptor family ... 113 3e-23 ref|XP_006339450.1| PREDICTED: cell division protein FtsY homolo... 112 5e-23 ref|XP_007220367.1| hypothetical protein PRUPE_ppa016987mg [Prun... 112 5e-23 ref|XP_007218168.1| hypothetical protein PRUPE_ppa007514mg [Prun... 112 5e-23 >gb|EXC28019.1| Cell division protein FtsY-like protein [Morus notabilis] Length = 371 Score = 119 bits (298), Expect = 6e-25 Identities = 59/59 (100%), Positives = 59/59 (100%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 394 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP Sbjct: 313 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 371 >ref|XP_002511808.1| cell division protein ftsy, putative [Ricinus communis] gi|223548988|gb|EEF50477.1| cell division protein ftsy, putative [Ricinus communis] Length = 362 Score = 117 bits (294), Expect = 2e-24 Identities = 58/59 (98%), Positives = 59/59 (100%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 394 +VVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP Sbjct: 304 EVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 362 >ref|XP_006445129.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|567905284|ref|XP_006445130.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|568875898|ref|XP_006491027.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Citrus sinensis] gi|557547391|gb|ESR58369.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] gi|557547392|gb|ESR58370.1| hypothetical protein CICLE_v10020663mg [Citrus clementina] Length = 372 Score = 116 bits (291), Expect = 4e-24 Identities = 58/58 (100%), Positives = 58/58 (100%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 397 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 314 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 371 >gb|EPS70118.1| hypothetical protein M569_04639, partial [Genlisea aurea] Length = 330 Score = 115 bits (289), Expect = 6e-24 Identities = 56/59 (94%), Positives = 58/59 (98%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 394 DVVG+TGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFD +AFVNAIFP Sbjct: 272 DVVGVTGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDPQAFVNAIFP 330 >ref|XP_003521235.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X1 [Glycine max] gi|571443916|ref|XP_006576355.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like isoform X2 [Glycine max] Length = 372 Score = 115 bits (289), Expect = 6e-24 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 397 DVVG+TGL+LTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 314 DVVGVTGLVLTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 371 >ref|XP_007135001.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] gi|561008046|gb|ESW06995.1| hypothetical protein PHAVU_010G093600g [Phaseolus vulgaris] Length = 371 Score = 115 bits (287), Expect = 1e-23 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 397 DVVG+TGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDA+AFVNAIF Sbjct: 313 DVVGVTGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDADAFVNAIF 370 >ref|XP_006583338.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Glycine max] Length = 372 Score = 115 bits (287), Expect = 1e-23 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 397 DVVG+TGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAE+FVNAIF Sbjct: 314 DVVGVTGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAESFVNAIF 371 >ref|XP_004510851.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Cicer arietinum] Length = 365 Score = 114 bits (286), Expect = 1e-23 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 397 +VVG+TGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 307 EVVGVTGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364 >ref|XP_003627628.1| Signal recognition 54 kDa protein [Medicago truncatula] gi|355521650|gb|AET02104.1| Signal recognition 54 kDa protein [Medicago truncatula] Length = 402 Score = 114 bits (286), Expect = 1e-23 Identities = 56/58 (96%), Positives = 58/58 (100%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 397 +VVG+TGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 344 EVVGVTGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 401 >gb|EMT07986.1| Cell division ftsY-like protein [Aegilops tauschii] Length = 370 Score = 114 bits (285), Expect = 2e-23 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 394 DVVGITG ILTKLDG+ARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFV AIFP Sbjct: 312 DVVGITGFILTKLDGTARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 370 >gb|EMS57234.1| Cell division protein ftsY-like protein [Triticum urartu] Length = 336 Score = 114 bits (285), Expect = 2e-23 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 394 DVVGITG ILTKLDG+ARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFV AIFP Sbjct: 278 DVVGITGFILTKLDGTARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 336 >dbj|BAJ86455.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326532852|dbj|BAJ89271.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 355 Score = 114 bits (285), Expect = 2e-23 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 394 DVVGITG ILTKLDG+ARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFV AIFP Sbjct: 297 DVVGITGFILTKLDGTARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVEAIFP 355 >ref|XP_007051904.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] gi|508704165|gb|EOX96061.1| Signal recognition particle receptor protein, chloroplast (FTSY) isoform 2 [Theobroma cacao] Length = 365 Score = 114 bits (284), Expect = 2e-23 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 394 +VVGITG ILTKLDGSARGGCVVSVVDELGIPVKF+GVGEG+EDLQPFDAEAFVNAIFP Sbjct: 307 EVVGITGFILTKLDGSARGGCVVSVVDELGIPVKFLGVGEGLEDLQPFDAEAFVNAIFP 365 >ref|XP_007051903.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] gi|508704164|gb|EOX96060.1| Signal recognition particle receptor protein isoform 1 [Theobroma cacao] Length = 445 Score = 114 bits (284), Expect = 2e-23 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 394 +VVGITG ILTKLDGSARGGCVVSVVDELGIPVKF+GVGEG+EDLQPFDAEAFVNAIFP Sbjct: 387 EVVGITGFILTKLDGSARGGCVVSVVDELGIPVKFLGVGEGLEDLQPFDAEAFVNAIFP 445 >ref|XP_003565107.1| PREDICTED: cell division protein ftsY homolog [Brachypodium distachyon] Length = 360 Score = 114 bits (284), Expect = 2e-23 Identities = 55/59 (93%), Positives = 57/59 (96%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 394 DVVGITG ILTKLDG+ARGGCVVSVVDELGIPVKFVG+GEGVEDLQPFDAEAFV AIFP Sbjct: 302 DVVGITGFILTKLDGTARGGCVVSVVDELGIPVKFVGIGEGVEDLQPFDAEAFVEAIFP 360 >ref|XP_006857853.1| hypothetical protein AMTR_s00069p00071970 [Amborella trichopoda] gi|548861955|gb|ERN19320.1| hypothetical protein AMTR_s00069p00071970 [Amborella trichopoda] Length = 402 Score = 113 bits (283), Expect = 3e-23 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 397 +VVGITGLILTKLDGSARGGCV SVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 344 EVVGITGLILTKLDGSARGGCVASVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 401 >ref|XP_002320775.1| signal recognition particle receptor family protein [Populus trichocarpa] gi|222861548|gb|EEE99090.1| signal recognition particle receptor family protein [Populus trichocarpa] Length = 365 Score = 113 bits (283), Expect = 3e-23 Identities = 56/58 (96%), Positives = 57/58 (98%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 397 +VVGITG ILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 307 EVVGITGFILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364 >ref|XP_006339450.1| PREDICTED: cell division protein FtsY homolog, chloroplastic-like [Solanum tuberosum] Length = 368 Score = 112 bits (281), Expect = 5e-23 Identities = 55/59 (93%), Positives = 58/59 (98%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIFP 394 +VVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGV+DLQPF+AE FVNAIFP Sbjct: 310 EVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVDDLQPFNAEEFVNAIFP 368 >ref|XP_007220367.1| hypothetical protein PRUPE_ppa016987mg [Prunus persica] gi|462416829|gb|EMJ21566.1| hypothetical protein PRUPE_ppa016987mg [Prunus persica] Length = 333 Score = 112 bits (281), Expect = 5e-23 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 397 ++VGITGLILTKLDGSARGGCVVSVV+ELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 275 EIVGITGLILTKLDGSARGGCVVSVVNELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 332 >ref|XP_007218168.1| hypothetical protein PRUPE_ppa007514mg [Prunus persica] gi|462414630|gb|EMJ19367.1| hypothetical protein PRUPE_ppa007514mg [Prunus persica] Length = 365 Score = 112 bits (281), Expect = 5e-23 Identities = 55/58 (94%), Positives = 58/58 (100%) Frame = -1 Query: 570 DVVGITGLILTKLDGSARGGCVVSVVDELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 397 ++VGITGLILTKLDGSARGGCVVSVV+ELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF Sbjct: 307 EIVGITGLILTKLDGSARGGCVVSVVNELGIPVKFVGVGEGVEDLQPFDAEAFVNAIF 364