BLASTX nr result
ID: Mentha22_contig00027467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00027467 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61298.1| hypothetical protein M569_13498, partial [Genlise... 57 3e-06 >gb|EPS61298.1| hypothetical protein M569_13498, partial [Genlisea aurea] Length = 329 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/72 (43%), Positives = 46/72 (63%), Gaps = 3/72 (4%) Frame = -3 Query: 319 VMIGGGSDDEWIGW---LVVKIIVYACLSTLLSLYXXXXXXVFFIYCKASRHELEFEIDS 149 V+IGGG D W+G+ L+++ ++ + T+L LY V F++CKASR EL FEI Sbjct: 249 VIIGGGGD--WMGFRWVLILETVICTGILTVLILYDVAGTAVLFMHCKASRGELAFEIAE 306 Query: 148 KLAGEYLRLPYD 113 + A EY+ LP+D Sbjct: 307 EFAREYVSLPFD 318