BLASTX nr result
ID: Mentha22_contig00027403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00027403 (1678 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45637.1| hypothetical protein MIMGU_mgv1a007414mg [Mimulus... 61 1e-06 >gb|EYU45637.1| hypothetical protein MIMGU_mgv1a007414mg [Mimulus guttatus] Length = 408 Score = 61.2 bits (147), Expect = 1e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -2 Query: 123 QFKPHQIXXXXXXXXAKFLNMNLASCHSVWHEFHTPPPVLR 1 QFKPHQI AKFLNMNL SCH+VW+ FHTPP VLR Sbjct: 358 QFKPHQIAAGAAYLAAKFLNMNLPSCHNVWNGFHTPPSVLR 398