BLASTX nr result
ID: Mentha22_contig00027176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00027176 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37854.1| hypothetical protein MIMGU_mgv1a000112mg [Mimulus... 60 4e-07 >gb|EYU37854.1| hypothetical protein MIMGU_mgv1a000112mg [Mimulus guttatus] Length = 1754 Score = 59.7 bits (143), Expect = 4e-07 Identities = 38/104 (36%), Positives = 54/104 (51%) Frame = -2 Query: 317 SNNKWSGNETASLPSPTPKQSNTGWSGGGEASHLTVKVQSPSVNGALPSPTKFSPNLATR 138 S KW+ N+ ++PSPTP Q HL +NGA+PSP + T Sbjct: 1417 SAEKWAVNDMTNMPSPTPTQRG----------HL--------INGAVPSPI-----IGTH 1453 Query: 137 TSNPTSVLNPVVQNTNFSPTPMSQHGISVNSAAPVHNQATSMNE 6 +S P SVL+ +++ FSPTP SQ G S SA H+ +T++ E Sbjct: 1454 SSTPASVLSAIIETATFSPTPNSQLGGS--SAVSRHSHSTTVTE 1495