BLASTX nr result
ID: Mentha22_contig00026422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00026422 (714 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37351.1| hypothetical protein MIMGU_mgv1a012936mg [Mimulus... 67 8e-09 >gb|EYU37351.1| hypothetical protein MIMGU_mgv1a012936mg [Mimulus guttatus] Length = 235 Score = 66.6 bits (161), Expect = 8e-09 Identities = 41/76 (53%), Positives = 48/76 (63%), Gaps = 10/76 (13%) Frame = -2 Query: 200 LSVQTHLIKTQVC----SLKCFDSCYASLSQT----RSPFFRGQFHSRHFVKFNRA-RPI 48 LSVQ H+ S K ++SLSQ RSPFFRGQFHSRHF++F + RP Sbjct: 8 LSVQAHVFNPMSSIHTHSSKPSAPSHSSLSQNPVSDRSPFFRGQFHSRHFIRFAQTRRPS 67 Query: 47 KNRAG-TVFSPRCVLP 3 KNRAG VFSPRCV+P Sbjct: 68 KNRAGFVVFSPRCVMP 83