BLASTX nr result
ID: Mentha22_contig00026404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00026404 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44529.1| hypothetical protein MIMGU_mgv1a007087mg [Mimulus... 58 1e-06 gb|EYU44528.1| hypothetical protein MIMGU_mgv1a007087mg [Mimulus... 58 1e-06 >gb|EYU44529.1| hypothetical protein MIMGU_mgv1a007087mg [Mimulus guttatus] Length = 372 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = +1 Query: 223 KQSRFVPFRNHSNGN--SLRVASPTSDVALELTDIDWDN 333 KQ+RF F NHSN N SLRVASPTS+VA EL DIDWDN Sbjct: 5 KQTRFASFSNHSNNNVNSLRVASPTSNVASELADIDWDN 43 >gb|EYU44528.1| hypothetical protein MIMGU_mgv1a007087mg [Mimulus guttatus] Length = 420 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = +1 Query: 223 KQSRFVPFRNHSNGN--SLRVASPTSDVALELTDIDWDN 333 KQ+RF F NHSN N SLRVASPTS+VA EL DIDWDN Sbjct: 53 KQTRFASFSNHSNNNVNSLRVASPTSNVASELADIDWDN 91