BLASTX nr result
ID: Mentha22_contig00025848
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00025848 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437821.1| hypothetical protein CICLE_v10033630mg, part... 69 7e-10 gb|EXB44932.1| hypothetical protein L484_026520 [Morus notabilis] 55 8e-06 >ref|XP_006437821.1| hypothetical protein CICLE_v10033630mg, partial [Citrus clementina] gi|557540017|gb|ESR51061.1| hypothetical protein CICLE_v10033630mg, partial [Citrus clementina] Length = 98 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/62 (53%), Positives = 44/62 (70%) Frame = +3 Query: 12 DLIFLVGIAAALTLLNLRYQYINGNPVPILFFHNKPTLFHLFLVALNFSFTAAVVTMSLR 191 +LI IA L L+ L Y+ I+GNPVP + F N+P LFH F++ALNFSF +V+T+SLR Sbjct: 1 ELILGFSIATTLVLVKLPYEKIDGNPVPTVIFKNRPGLFHAFILALNFSFFGSVLTISLR 60 Query: 192 DK 197 K Sbjct: 61 GK 62 >gb|EXB44932.1| hypothetical protein L484_026520 [Morus notabilis] Length = 150 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/68 (38%), Positives = 42/68 (61%) Frame = +3 Query: 6 VEDLIFLVGIAAALTLLNLRYQYINGNPVPILFFHNKPTLFHLFLVALNFSFTAAVVTMS 185 +E++I V IA AL LL L Y+ N P+P + F+ +P+ FH F++ALNF+ + + + Sbjct: 11 LEEVILWVSIAMALALLLLPYEDTNERPLPAIIFNGQPSSFHAFILALNFALFGSFLAII 70 Query: 186 LRDKSPTL 209 LR P + Sbjct: 71 LRRSGPKI 78