BLASTX nr result
ID: Mentha22_contig00025735
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00025735 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHL84163.1| cystathionine gamma synthase [Nicotiana tabacum] 115 5e-24 gb|AGT40329.1| cystathionine gamma synthase [Nicotiana attenuata] 115 5e-24 gb|EYU44131.1| hypothetical protein MIMGU_mgv1a002982mg [Mimulus... 115 8e-24 ref|NP_001275144.1| cystathionine gamma-synthase isoform 2 [Sola... 114 1e-23 ref|XP_006373333.1| hypothetical protein POPTR_0017s12240g [Popu... 114 1e-23 emb|CBI22246.3| unnamed protein product [Vitis vinifera] 114 1e-23 ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chl... 114 1e-23 ref|XP_002323872.1| cystathionine gamma synthase family protein ... 114 1e-23 gb|ABK96139.1| unknown [Populus trichocarpa] 114 1e-23 gb|AAF74981.1|AF082891_1 cystathionine gamma-synthase isoform 1 ... 114 2e-23 ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycope... 114 2e-23 gb|EYU34642.1| hypothetical protein MIMGU_mgv1a004543mg [Mimulus... 113 3e-23 emb|CAA56143.1| CYS1 [Arabidopsis thaliana] 113 3e-23 emb|CAA64383.1| cystathionine gamma-synthase [Arabidopsis thaliana] 113 3e-23 gb|AAC25687.1| cystathionine gamma-synthase precursor [Arabidops... 113 3e-23 gb|AAC49574.1| similar to the metB gene product of Escherichia c... 113 3e-23 ref|NP_186761.1| cystathionine gamma-synthase [Arabidopsis thali... 113 3e-23 ref|XP_002882199.1| hypothetical protein ARALYDRAFT_477417 [Arab... 113 3e-23 gb|AHM22940.1| cystathionine gamma synthase [Nicotiana tabacum] 112 4e-23 pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana ... 112 4e-23 >gb|AHL84163.1| cystathionine gamma synthase [Nicotiana tabacum] Length = 527 Score = 115 bits (289), Expect = 5e-24 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL +S+RAKYGILDNLVRFSFGVEDFEDLKAD+LQALE I Sbjct: 468 APSFGGCESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKADILQALEAI 527 >gb|AGT40329.1| cystathionine gamma synthase [Nicotiana attenuata] Length = 553 Score = 115 bits (289), Expect = 5e-24 Identities = 55/60 (91%), Positives = 58/60 (96%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL +S+RAKYGILDNLVRFSFGVEDFEDLKAD+LQALE I Sbjct: 494 APSFGGCESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDLKADILQALEAI 553 >gb|EYU44131.1| hypothetical protein MIMGU_mgv1a002982mg [Mimulus guttatus] Length = 619 Score = 115 bits (287), Expect = 8e-24 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL SERAKYGI+DNLVRFSFGVEDFEDLKAD+LQALE I Sbjct: 560 APSFGGCESIVDQPAIMSYWDLSPSERAKYGIMDNLVRFSFGVEDFEDLKADILQALEKI 619 >ref|NP_001275144.1| cystathionine gamma-synthase isoform 2 [Solanum tuberosum] gi|8439543|gb|AAF74982.1|AF082892_1 cystathionine gamma-synthase isoform 2 [Solanum tuberosum] Length = 540 Score = 114 bits (286), Expect = 1e-23 Identities = 54/58 (93%), Positives = 56/58 (96%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALE 259 APSFGGCESIVDQPAIMSYWDL SERAKYGI+DNLVRFSFGVEDFEDLKAD+LQALE Sbjct: 481 APSFGGCESIVDQPAIMSYWDLKESERAKYGIMDNLVRFSFGVEDFEDLKADILQALE 538 >ref|XP_006373333.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa] gi|550320107|gb|ERP51130.1| hypothetical protein POPTR_0017s12240g [Populus trichocarpa] Length = 548 Score = 114 bits (285), Expect = 1e-23 Identities = 55/60 (91%), Positives = 56/60 (93%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL RSER KYGI DNLVRFSFGVEDFEDLKAD+LQALE I Sbjct: 486 APSFGGCESIVDQPAIMSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI 545 >emb|CBI22246.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 114 bits (285), Expect = 1e-23 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL +SERAKYGI DNLVRFSFGVEDFEDLKAD+LQALE I Sbjct: 438 APSFGGCESIVDQPAIMSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKADILQALESI 497 >ref|XP_002283866.1| PREDICTED: cystathionine gamma-synthase, chloroplastic-like [Vitis vinifera] Length = 531 Score = 114 bits (285), Expect = 1e-23 Identities = 55/60 (91%), Positives = 57/60 (95%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL +SERAKYGI DNLVRFSFGVEDFEDLKAD+LQALE I Sbjct: 472 APSFGGCESIVDQPAIMSYWDLNQSERAKYGIQDNLVRFSFGVEDFEDLKADILQALESI 531 >ref|XP_002323872.1| cystathionine gamma synthase family protein [Populus trichocarpa] gi|222866874|gb|EEF04005.1| cystathionine gamma synthase family protein [Populus trichocarpa] Length = 532 Score = 114 bits (285), Expect = 1e-23 Identities = 55/60 (91%), Positives = 56/60 (93%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL RSER KYGI DNLVRFSFGVEDFEDLKAD+LQALE I Sbjct: 470 APSFGGCESIVDQPAIMSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI 529 >gb|ABK96139.1| unknown [Populus trichocarpa] Length = 310 Score = 114 bits (285), Expect = 1e-23 Identities = 55/60 (91%), Positives = 56/60 (93%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL RSER KYGI DNLVRFSFGVEDFEDLKAD+LQALE I Sbjct: 248 APSFGGCESIVDQPAIMSYWDLSRSEREKYGIKDNLVRFSFGVEDFEDLKADILQALETI 307 >gb|AAF74981.1|AF082891_1 cystathionine gamma-synthase isoform 1 [Solanum tuberosum] Length = 539 Score = 114 bits (284), Expect = 2e-23 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL +S+RAKYGILDNLVRFSFGVEDFED+KADVLQAL+ I Sbjct: 480 APSFGGCESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI 539 >ref|NP_001234489.1| cystathionine gamma synthase [Solanum lycopersicum] gi|40806079|gb|AAR92031.1| cystathionine gamma synthase [Solanum lycopersicum] Length = 540 Score = 114 bits (284), Expect = 2e-23 Identities = 54/60 (90%), Positives = 58/60 (96%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL +S+RAKYGILDNLVRFSFGVEDFED+KADVLQAL+ I Sbjct: 481 APSFGGCESIVDQPAIMSYWDLSQSDRAKYGILDNLVRFSFGVEDFEDVKADVLQALDSI 540 >gb|EYU34642.1| hypothetical protein MIMGU_mgv1a004543mg [Mimulus guttatus] Length = 521 Score = 113 bits (282), Expect = 3e-23 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL + ERAKYGI+DNLVRFSFGVEDFEDLK D+LQALE I Sbjct: 462 APSFGGCESIVDQPAIMSYWDLSQKERAKYGIMDNLVRFSFGVEDFEDLKTDILQALEKI 521 >emb|CAA56143.1| CYS1 [Arabidopsis thaliana] Length = 224 Score = 113 bits (282), Expect = 3e-23 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDLP+ ER KYGI DNLVRFSFGVEDFED+KAD+LQALE I Sbjct: 165 APSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 224 >emb|CAA64383.1| cystathionine gamma-synthase [Arabidopsis thaliana] Length = 563 Score = 113 bits (282), Expect = 3e-23 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDLP+ ER KYGI DNLVRFSFGVEDFED+KAD+LQALE I Sbjct: 504 APSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563 >gb|AAC25687.1| cystathionine gamma-synthase precursor [Arabidopsis thaliana] Length = 563 Score = 113 bits (282), Expect = 3e-23 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDLP+ ER KYGI DNLVRFSFGVEDFED+KAD+LQALE I Sbjct: 504 APSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563 >gb|AAC49574.1| similar to the metB gene product of Escherichia coli; cloned by functional complementation of a metB mutant strain of Escherichia coli LE392 [Arabidopsis thaliana] Length = 563 Score = 113 bits (282), Expect = 3e-23 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDLP+ ER KYGI DNLVRFSFGVEDFED+KAD+LQALE I Sbjct: 504 APSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563 >ref|NP_186761.1| cystathionine gamma-synthase [Arabidopsis thaliana] gi|21542422|sp|P55217.3|METB_ARATH RecName: Full=Cystathionine gamma-synthase, chloroplastic; Short=CGS; AltName: Full=O-succinylhomoserine (thiol)-lyase; Flags: Precursor gi|6714476|gb|AAF26162.1|AC008261_19 putative cystathionine gamma-synthase [Arabidopsis thaliana] gi|1791309|gb|AAB41235.1| cystathionine gamma-synthase [Arabidopsis thaliana] gi|2852454|dbj|BAA24699.1| cystathionine gamma-synthase [Arabidopsis thaliana] gi|20453137|gb|AAM19810.1| AT3g01120/T4P13_19 [Arabidopsis thaliana] gi|27754257|gb|AAO22582.1| putative cystathionine gamma-synthase [Arabidopsis thaliana] gi|332640091|gb|AEE73612.1| cystathionine gamma-synthase [Arabidopsis thaliana] Length = 563 Score = 113 bits (282), Expect = 3e-23 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDLP+ ER KYGI DNLVRFSFGVEDFED+KAD+LQALE I Sbjct: 504 APSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 563 >ref|XP_002882199.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. lyrata] gi|297328039|gb|EFH58458.1| hypothetical protein ARALYDRAFT_477417 [Arabidopsis lyrata subsp. lyrata] Length = 564 Score = 113 bits (282), Expect = 3e-23 Identities = 53/60 (88%), Positives = 56/60 (93%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDLP+ ER KYGI DNLVRFSFGVEDFED+KAD+LQALE I Sbjct: 505 APSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQALEAI 564 >gb|AHM22940.1| cystathionine gamma synthase [Nicotiana tabacum] Length = 540 Score = 112 bits (281), Expect = 4e-23 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL +S+RAKYGI+DNLVRFSFGVEDF+DLKAD+LQAL+ I Sbjct: 481 APSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI 540 >pdb|1QGN|A Chain A, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822271|pdb|1QGN|B Chain B, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822272|pdb|1QGN|C Chain C, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822273|pdb|1QGN|D Chain D, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822274|pdb|1QGN|E Chain E, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822275|pdb|1QGN|F Chain F, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822276|pdb|1QGN|G Chain G, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|5822277|pdb|1QGN|H Chain H, Cystathionine Gamma-Synthase From Nicotiana Tabacum gi|15826471|pdb|1I41|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826472|pdb|1I41|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826473|pdb|1I41|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826474|pdb|1I41|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826475|pdb|1I41|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826476|pdb|1I41|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826477|pdb|1I41|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826478|pdb|1I41|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826479|pdb|1I41|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826480|pdb|1I41|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826481|pdb|1I41|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826482|pdb|1I41|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Appa gi|15826483|pdb|1I43|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826484|pdb|1I43|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826485|pdb|1I43|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826486|pdb|1I43|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826487|pdb|1I43|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826488|pdb|1I43|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826489|pdb|1I43|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826490|pdb|1I43|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826491|pdb|1I43|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826492|pdb|1I43|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826493|pdb|1I43|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826494|pdb|1I43|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ppca gi|15826495|pdb|1I48|A Chain A, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826496|pdb|1I48|B Chain B, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826497|pdb|1I48|C Chain C, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826498|pdb|1I48|D Chain D, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826499|pdb|1I48|E Chain E, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826500|pdb|1I48|F Chain F, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826501|pdb|1I48|G Chain G, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826502|pdb|1I48|H Chain H, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826503|pdb|1I48|I Chain I, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826504|pdb|1I48|J Chain J, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826505|pdb|1I48|K Chain K, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|15826506|pdb|1I48|L Chain L, Cystathionine Gamma-Synthase In Complex With The Inhibitor Ctcpo gi|4322948|gb|AAD16143.1| cystathionine gamma-synthase precursor [Nicotiana tabacum] Length = 445 Score = 112 bits (281), Expect = 4e-23 Identities = 52/60 (86%), Positives = 58/60 (96%) Frame = -1 Query: 432 APSFGGCESIVDQPAIMSYWDLPRSERAKYGILDNLVRFSFGVEDFEDLKADVLQALEMI 253 APSFGGCESIVDQPAIMSYWDL +S+RAKYGI+DNLVRFSFGVEDF+DLKAD+LQAL+ I Sbjct: 386 APSFGGCESIVDQPAIMSYWDLSQSDRAKYGIMDNLVRFSFGVEDFDDLKADILQALDSI 445