BLASTX nr result
ID: Mentha22_contig00025664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00025664 (309 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64184.1| hypothetical protein M569_10599, partial [Genlise... 67 3e-09 ref|XP_004236976.1| PREDICTED: uncharacterized protein LOC101252... 56 6e-06 >gb|EPS64184.1| hypothetical protein M569_10599, partial [Genlisea aurea] Length = 230 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = +3 Query: 42 DHNPNKIQMQQQVQESGFVISNQYDQNHPQIHHPQQFVHSGNQYIPASAM 191 D + N I++Q VQE G+V+S Q+DQ+HPQ+HHPQQF+ +GNQ+IPA M Sbjct: 36 DMDSNSIKIQ--VQEPGYVLSGQFDQSHPQMHHPQQFIPAGNQFIPAGPM 83 >ref|XP_004236976.1| PREDICTED: uncharacterized protein LOC101252579 [Solanum lycopersicum] Length = 682 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/58 (50%), Positives = 40/58 (68%) Frame = +3 Query: 3 NMVAANPSDLKSGDHNPNKIQMQQQVQESGFVISNQYDQNHPQIHHPQQFVHSGNQYI 176 N V+AN D+K D N QQQVQE+G+ +S +YDQ H Q++ PQQ+VH+ +QYI Sbjct: 426 NRVSANSVDMKQSDPNNRAQVQQQQVQEAGYAMSVKYDQ-HQQMYQPQQYVHA-SQYI 481