BLASTX nr result
ID: Mentha22_contig00023991
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00023991 (779 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006466325.1| PREDICTED: putative U-box domain-containing ... 68 4e-09 ref|XP_006426256.1| hypothetical protein CICLE_v10024909mg [Citr... 68 4e-09 ref|XP_006426255.1| hypothetical protein CICLE_v10024909mg [Citr... 68 4e-09 ref|XP_004288524.1| PREDICTED: putative U-box domain-containing ... 68 4e-09 ref|XP_007208084.1| hypothetical protein PRUPE_ppa001508mg [Prun... 64 5e-08 ref|XP_002310308.2| kinase family protein [Populus trichocarpa] ... 64 8e-08 ref|XP_007047770.1| U-box domain-containing protein kinase famil... 63 1e-07 ref|XP_006587576.1| PREDICTED: putative U-box domain-containing ... 62 2e-07 ref|XP_006587575.1| PREDICTED: putative U-box domain-containing ... 62 2e-07 ref|XP_006394022.1| hypothetical protein EUTSA_v10003671mg [Eutr... 62 2e-07 ref|XP_002866675.1| kinase family protein [Arabidopsis lyrata su... 62 2e-07 ref|NP_201353.4| U-box domain-containing protein kinase family p... 62 2e-07 sp|Q9FGD7.1|PUB50_ARATH RecName: Full=Putative U-box domain-cont... 62 2e-07 ref|XP_006572996.1| PREDICTED: putative U-box domain-containing ... 62 2e-07 ref|XP_007158363.1| hypothetical protein PHAVU_002G146600g [Phas... 62 3e-07 ref|XP_004160941.1| PREDICTED: putative U-box domain-containing ... 61 5e-07 ref|XP_004143547.1| PREDICTED: putative U-box domain-containing ... 61 5e-07 gb|EXC35471.1| Putative U-box domain-containing protein 50 [Moru... 60 7e-07 ref|XP_003613040.1| U-box domain-containing protein [Medicago tr... 60 9e-07 ref|XP_006279476.1| hypothetical protein CARUB_v10025893mg, part... 60 1e-06 >ref|XP_006466325.1| PREDICTED: putative U-box domain-containing protein 50-like [Citrus sinensis] Length = 808 Score = 67.8 bits (164), Expect = 4e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRST 672 GHDTSPMTNLRLKHK L PNHTLRSLI++W NK+S+ Sbjct: 770 GHDTSPMTNLRLKHKYLTPNHTLRSLIQEWHNKQSS 805 >ref|XP_006426256.1| hypothetical protein CICLE_v10024909mg [Citrus clementina] gi|557528246|gb|ESR39496.1| hypothetical protein CICLE_v10024909mg [Citrus clementina] Length = 760 Score = 67.8 bits (164), Expect = 4e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRST 672 GHDTSPMTNLRLKHK L PNHTLRSLI++W NK+S+ Sbjct: 722 GHDTSPMTNLRLKHKYLTPNHTLRSLIQEWHNKQSS 757 >ref|XP_006426255.1| hypothetical protein CICLE_v10024909mg [Citrus clementina] gi|557528245|gb|ESR39495.1| hypothetical protein CICLE_v10024909mg [Citrus clementina] Length = 808 Score = 67.8 bits (164), Expect = 4e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRST 672 GHDTSPMTNLRLKHK L PNHTLRSLI++W NK+S+ Sbjct: 770 GHDTSPMTNLRLKHKYLTPNHTLRSLIQEWHNKQSS 805 >ref|XP_004288524.1| PREDICTED: putative U-box domain-containing protein 50-like [Fragaria vesca subsp. vesca] Length = 798 Score = 67.8 bits (164), Expect = 4e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 GHDTSPMTNL+LKH +L PNHTLRSLI+DW NKRS Sbjct: 760 GHDTSPMTNLKLKHTVLTPNHTLRSLIQDWHNKRS 794 >ref|XP_007208084.1| hypothetical protein PRUPE_ppa001508mg [Prunus persica] gi|462403726|gb|EMJ09283.1| hypothetical protein PRUPE_ppa001508mg [Prunus persica] Length = 812 Score = 64.3 bits (155), Expect = 5e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKR 678 GHDTSPMTNLRL+H L PNHTLRSLI++W NKR Sbjct: 774 GHDTSPMTNLRLRHTFLTPNHTLRSLIQEWHNKR 807 >ref|XP_002310308.2| kinase family protein [Populus trichocarpa] gi|550334856|gb|EEE90758.2| kinase family protein [Populus trichocarpa] Length = 718 Score = 63.5 bits (153), Expect = 8e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 773 DTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRSTA 669 DTSPMTNLRLKHK L PNHTLRSLI++W+ ++STA Sbjct: 683 DTSPMTNLRLKHKFLTPNHTLRSLIQEWNRRKSTA 717 >ref|XP_007047770.1| U-box domain-containing protein kinase family protein, putative [Theobroma cacao] gi|508700031|gb|EOX91927.1| U-box domain-containing protein kinase family protein, putative [Theobroma cacao] Length = 803 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 GHDTSPMTNL LKHK L PNHTLR LI++W NK S Sbjct: 765 GHDTSPMTNLSLKHKFLTPNHTLRCLIQEWQNKGS 799 >ref|XP_006587576.1| PREDICTED: putative U-box domain-containing protein 50-like isoform X2 [Glycine max] Length = 753 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRST 672 G DTSPMTNLRLKH L PNHTLRSLI+DW +ST Sbjct: 718 GRDTSPMTNLRLKHTFLTPNHTLRSLIQDWQTNKST 753 >ref|XP_006587575.1| PREDICTED: putative U-box domain-containing protein 50-like isoform X1 [Glycine max] Length = 800 Score = 62.4 bits (150), Expect = 2e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRST 672 G DTSPMTNLRLKH L PNHTLRSLI+DW +ST Sbjct: 765 GRDTSPMTNLRLKHTFLTPNHTLRSLIQDWQTNKST 800 >ref|XP_006394022.1| hypothetical protein EUTSA_v10003671mg [Eutrema salsugineum] gi|557090661|gb|ESQ31308.1| hypothetical protein EUTSA_v10003671mg [Eutrema salsugineum] Length = 794 Score = 62.4 bits (150), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 GHDTSPMTNLRL +++L PNHTLRSLI+DW +KR+ Sbjct: 755 GHDTSPMTNLRLDYQILTPNHTLRSLIQDWHSKRA 789 >ref|XP_002866675.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297312510|gb|EFH42934.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 767 Score = 62.4 bits (150), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 GHDTSPMTNLRL +++L PNHTLRSLI+DW +KR+ Sbjct: 728 GHDTSPMTNLRLDYQMLTPNHTLRSLIQDWHSKRA 762 >ref|NP_201353.4| U-box domain-containing protein kinase family protein [Arabidopsis thaliana] gi|332010681|gb|AED98064.1| U-box domain-containing protein kinase family protein [Arabidopsis thaliana] Length = 791 Score = 62.4 bits (150), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 GHDTSPMTNLRL +++L PNHTLRSLI+DW +KR+ Sbjct: 752 GHDTSPMTNLRLDYQMLTPNHTLRSLIQDWHSKRA 786 >sp|Q9FGD7.1|PUB50_ARATH RecName: Full=Putative U-box domain-containing protein 50; AltName: Full=Plant U-box protein 50 gi|10257488|dbj|BAB11278.1| unnamed protein product [Arabidopsis thaliana] Length = 765 Score = 62.4 bits (150), Expect = 2e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 GHDTSPMTNLRL +++L PNHTLRSLI+DW +KR+ Sbjct: 726 GHDTSPMTNLRLDYQMLTPNHTLRSLIQDWHSKRA 760 >ref|XP_006572996.1| PREDICTED: putative U-box domain-containing protein 50-like [Glycine max] Length = 801 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRST 672 G DTSP+TNLRLKH L PNHTLRSLIEDW +ST Sbjct: 766 GRDTSPVTNLRLKHTFLTPNHTLRSLIEDWQTNKST 801 >ref|XP_007158363.1| hypothetical protein PHAVU_002G146600g [Phaseolus vulgaris] gi|561031778|gb|ESW30357.1| hypothetical protein PHAVU_002G146600g [Phaseolus vulgaris] Length = 803 Score = 61.6 bits (148), Expect = 3e-07 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 G DTSPMTNLRLKH L PNHTLRSLIEDW +S Sbjct: 764 GRDTSPMTNLRLKHTFLTPNHTLRSLIEDWQTNKS 798 >ref|XP_004160941.1| PREDICTED: putative U-box domain-containing protein 50-like [Cucumis sativus] Length = 775 Score = 60.8 bits (146), Expect = 5e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 GH+TSPMTNL+L+H L PNHTLRSLI+DW N+ S Sbjct: 739 GHETSPMTNLKLQHPYLTPNHTLRSLIQDWQNENS 773 >ref|XP_004143547.1| PREDICTED: putative U-box domain-containing protein 50-like [Cucumis sativus] Length = 806 Score = 60.8 bits (146), Expect = 5e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 GH+TSPMTNL+L+H L PNHTLRSLI+DW N+ S Sbjct: 770 GHETSPMTNLKLQHPYLTPNHTLRSLIQDWQNENS 804 >gb|EXC35471.1| Putative U-box domain-containing protein 50 [Morus notabilis] Length = 63 Score = 60.5 bits (145), Expect = 7e-07 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 G+DTSPMTNL+LKH L NHTLR+LI+DW NKRS Sbjct: 25 GNDTSPMTNLKLKHTFLTSNHTLRTLIQDWHNKRS 59 >ref|XP_003613040.1| U-box domain-containing protein [Medicago truncatula] gi|355514375|gb|AES95998.1| U-box domain-containing protein [Medicago truncatula] Length = 808 Score = 60.1 bits (144), Expect = 9e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 GHDTSPMTNLRLKH L PNH LRS +E+W +K+S Sbjct: 769 GHDTSPMTNLRLKHTSLTPNHILRSFLEEWQSKKS 803 >ref|XP_006279476.1| hypothetical protein CARUB_v10025893mg, partial [Capsella rubella] gi|482548180|gb|EOA12374.1| hypothetical protein CARUB_v10025893mg, partial [Capsella rubella] Length = 825 Score = 59.7 bits (143), Expect = 1e-06 Identities = 24/35 (68%), Positives = 32/35 (91%) Frame = -1 Query: 779 GHDTSPMTNLRLKHKLLVPNHTLRSLIEDWSNKRS 675 GHDTSPMTNLRL +++L PNHTLR+LI+DW +K++ Sbjct: 786 GHDTSPMTNLRLDYQVLTPNHTLRALIQDWHSKKA 820