BLASTX nr result
ID: Mentha22_contig00022906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00022906 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 60 2e-07 gb|EXB68717.1| hypothetical protein L484_024737 [Morus notabilis] 55 8e-06 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +1 Query: 19 FTRLSPNEYADLRAKGLCFRCKKPYTPGHECPLKQLRVLLAEEDE 153 FT LS NE + + KGLCF+C P+ P H+CP KQLRVL+ EEDE Sbjct: 96 FTHLSYNELMERKQKGLCFKCGGPFHPMHQCPDKQLRVLVLEEDE 140 >gb|EXB68717.1| hypothetical protein L484_024737 [Morus notabilis] Length = 1447 Score = 55.5 bits (132), Expect = 8e-06 Identities = 35/96 (36%), Positives = 49/96 (51%), Gaps = 7/96 (7%) Frame = +1 Query: 19 FTRLSPNEYADLRAKGLCFRCKKPYTPGHECPLKQLRVLL-----AEEDELLDFSRAEFL 183 F RLS E RA+GLCFRC + ++PGH C L+QL+VLL ++ +E L AE Sbjct: 373 FRRLSYEEIQQKRARGLCFRCDEEFSPGHRCKLRQLQVLLVSGEDSDREEDLREESAEAA 432 Query: 184 ETMGPFDPGDPNEELG--WR*SRFSSNYLISTLGTR 285 G G+ + L W + + L T+G R Sbjct: 433 TVQGETTKGNVDLSLNSLWGFASAKTMKLRGTIGDR 468