BLASTX nr result
ID: Mentha22_contig00022852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00022852 (1260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27876.1| hypothetical protein MIMGU_mgv1a000137mg [Mimulus... 67 1e-08 gb|EYU27875.1| hypothetical protein MIMGU_mgv1a001357mg [Mimulus... 63 2e-07 >gb|EYU27876.1| hypothetical protein MIMGU_mgv1a000137mg [Mimulus guttatus] Length = 1649 Score = 67.4 bits (163), Expect = 1e-08 Identities = 37/61 (60%), Positives = 43/61 (70%), Gaps = 10/61 (16%) Frame = -3 Query: 1165 GGKAERKKVFEAEQAFSSDSTAIVLKEESEVDNIEELPLFTFD----------EHNLLGW 1016 GGK + K++FEAEQ SSDSTAIVLK+ES NIEELPLFTF+ E+NLLG Sbjct: 462 GGKTKEKRIFEAEQTLSSDSTAIVLKDESGKINIEELPLFTFETLANATDQFHENNLLGR 521 Query: 1015 G 1013 G Sbjct: 522 G 522 >gb|EYU27875.1| hypothetical protein MIMGU_mgv1a001357mg [Mimulus guttatus] Length = 834 Score = 63.2 bits (152), Expect = 2e-07 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 10/59 (16%) Frame = -3 Query: 1159 KAERKKVFEAEQAFSSDSTAIVLKEESEVDNIEELPLFTFD----------EHNLLGWG 1013 K + KVFEA Q FSSDST+IVLK+ESE NIEELPLFTF+ E+NLLG G Sbjct: 468 KTKETKVFEAGQTFSSDSTSIVLKDESEKVNIEELPLFTFETLANATDQFHENNLLGRG 526