BLASTX nr result
ID: Mentha22_contig00022815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00022815 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25291.1| hypothetical protein MIMGU_mgv1a011062mg [Mimulus... 95 1e-17 ref|XP_006359534.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 82 1e-13 ref|XP_006659279.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 70 2e-10 ref|XP_006659278.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 70 2e-10 ref|NP_001061466.1| Os08g0292600 [Oryza sativa Japonica Group] g... 70 2e-10 gb|EEE68416.1| hypothetical protein OsJ_26776 [Oryza sativa Japo... 70 2e-10 dbj|BAH00420.1| unnamed protein product [Oryza sativa Japonica G... 70 2e-10 ref|XP_002523550.1| peptidyl-prolyl cis-trans isomerase, putativ... 70 3e-10 ref|XP_004973170.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 70 4e-10 ref|XP_002468667.1| hypothetical protein SORBIDRAFT_01g049960 [S... 70 4e-10 ref|NP_001132234.1| putative peptidyl-prolyl cis-trans isomerase... 70 4e-10 ref|XP_006848823.1| hypothetical protein AMTR_s00026p00161370 [A... 69 9e-10 gb|EMS67885.1| Peptidyl-prolyl cis-trans isomerase B [Triticum u... 69 9e-10 ref|XP_007202379.1| hypothetical protein PRUPE_ppa009354mg [Prun... 67 2e-09 ref|XP_003573666.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 67 2e-09 ref|NP_198360.2| cyclophilin-like peptidyl-prolyl cis-trans isom... 64 2e-08 ref|XP_006395974.1| hypothetical protein EUTSA_v10004727mg [Eutr... 64 2e-08 ref|XP_006284284.1| hypothetical protein CARUB_v10005453mg [Caps... 64 2e-08 ref|XP_002870416.1| peptidyl-prolyl cis-trans isomerase [Arabido... 64 2e-08 ref|NP_001078636.1| cyclophilin-like peptidyl-prolyl cis-trans i... 64 2e-08 >gb|EYU25291.1| hypothetical protein MIMGU_mgv1a011062mg [Mimulus guttatus] Length = 293 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/49 (87%), Positives = 47/49 (95%) Frame = -1 Query: 149 PDTTVTDRVFLDFSICPAYFLSRTLGESDLSRCAESEPLGRVVLGLYGN 3 PDTT+TDRVFLDFS+CP+YF SRTLGESDLS C+ESEPLGRVVLGLYGN Sbjct: 52 PDTTITDRVFLDFSLCPSYFQSRTLGESDLSLCSESEPLGRVVLGLYGN 100 >ref|XP_006359534.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B-like [Solanum tuberosum] Length = 297 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = -1 Query: 149 PDTTVTDRVFLDFSICPAYFLSRTLGESDLSRCAESEPLGRVVLGLYGN 3 PDTT+T+RVFLDFSICP YF +R LG+ DLS CA+SEP+GR+VLGLYGN Sbjct: 57 PDTTITERVFLDFSICPNYFTNRNLGD-DLSNCADSEPIGRLVLGLYGN 104 >ref|XP_006659279.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B-like isoform X2 [Oryza brachyantha] Length = 326 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/48 (66%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -1 Query: 146 DTTVTDRVFLDFSICPAYFLS-RTLGESDLSRCAESEPLGRVVLGLYG 6 DTT+TDR+F+DFS+CP+YF S RTLG ++L+ C +SEPLGRV+ GLYG Sbjct: 87 DTTITDRIFMDFSVCPSYFRSDRTLG-AELATCPDSEPLGRVIFGLYG 133 >ref|XP_006659278.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B-like isoform X1 [Oryza brachyantha] Length = 373 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/48 (66%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -1 Query: 146 DTTVTDRVFLDFSICPAYFLS-RTLGESDLSRCAESEPLGRVVLGLYG 6 DTT+TDR+F+DFS+CP+YF S RTLG ++L+ C +SEPLGRV+ GLYG Sbjct: 134 DTTITDRIFMDFSVCPSYFRSDRTLG-AELATCPDSEPLGRVIFGLYG 180 >ref|NP_001061466.1| Os08g0292600 [Oryza sativa Japonica Group] gi|28564614|dbj|BAC57781.1| unknown protein [Oryza sativa Japonica Group] gi|38175505|dbj|BAD01200.1| unknown protein [Oryza sativa Japonica Group] gi|113623435|dbj|BAF23380.1| Os08g0292600 [Oryza sativa Japonica Group] gi|215697323|dbj|BAG91317.1| unnamed protein product [Oryza sativa Japonica Group] Length = 327 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/48 (66%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -1 Query: 146 DTTVTDRVFLDFSICPAYFLS-RTLGESDLSRCAESEPLGRVVLGLYG 6 DTT+TDR+F+DFS+CP+YF S RTLG ++L+ C +SEPLGRV+ GLYG Sbjct: 88 DTTITDRIFMDFSVCPSYFRSDRTLG-AELATCPDSEPLGRVIFGLYG 134 >gb|EEE68416.1| hypothetical protein OsJ_26776 [Oryza sativa Japonica Group] Length = 314 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/48 (66%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -1 Query: 146 DTTVTDRVFLDFSICPAYFLS-RTLGESDLSRCAESEPLGRVVLGLYG 6 DTT+TDR+F+DFS+CP+YF S RTLG ++L+ C +SEPLGRV+ GLYG Sbjct: 75 DTTITDRIFMDFSVCPSYFRSDRTLG-AELATCPDSEPLGRVIFGLYG 121 >dbj|BAH00420.1| unnamed protein product [Oryza sativa Japonica Group] Length = 258 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/48 (66%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -1 Query: 146 DTTVTDRVFLDFSICPAYFLS-RTLGESDLSRCAESEPLGRVVLGLYG 6 DTT+TDR+F+DFS+CP+YF S RTLG ++L+ C +SEPLGRV+ GLYG Sbjct: 88 DTTITDRIFMDFSVCPSYFRSDRTLG-AELATCPDSEPLGRVIFGLYG 134 >ref|XP_002523550.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] gi|223537257|gb|EEF38889.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] Length = 296 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/50 (64%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -1 Query: 152 KPDTTVTDRVFLDFSICPAYFL-SRTLGESDLSRCAESEPLGRVVLGLYG 6 +PDTT+TDRV++DFS+CP YF RTL ++ S C ES PLGRV+LGLYG Sbjct: 55 QPDTTITDRVYMDFSLCPNYFRPDRTLSDTVSSLCTESTPLGRVILGLYG 104 >ref|XP_004973170.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like isoform X1 [Setaria italica] gi|514794909|ref|XP_004973171.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like isoform X2 [Setaria italica] gi|514794913|ref|XP_004973172.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic-like isoform X3 [Setaria italica] Length = 326 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/48 (68%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -1 Query: 146 DTTVTDRVFLDFSICPAYFLS-RTLGESDLSRCAESEPLGRVVLGLYG 6 DTT+TDR+F+DFS+CP+YF S R LG ++LS C +SEPLGRVV GLYG Sbjct: 87 DTTITDRIFMDFSVCPSYFRSDRPLG-AELSSCPDSEPLGRVVFGLYG 133 >ref|XP_002468667.1| hypothetical protein SORBIDRAFT_01g049960 [Sorghum bicolor] gi|241922521|gb|EER95665.1| hypothetical protein SORBIDRAFT_01g049960 [Sorghum bicolor] Length = 326 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/48 (68%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -1 Query: 146 DTTVTDRVFLDFSICPAYFLS-RTLGESDLSRCAESEPLGRVVLGLYG 6 DTT+TDR+F+DFS+CP+YF S R LG ++LS C +SEPLGRVV GLYG Sbjct: 87 DTTITDRIFMDFSVCPSYFRSDRPLG-AELSSCPDSEPLGRVVFGLYG 133 >ref|NP_001132234.1| putative peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Zea mays] gi|194693838|gb|ACF81003.1| unknown [Zea mays] gi|194697464|gb|ACF82816.1| unknown [Zea mays] gi|195616700|gb|ACG30180.1| peptidyl-prolyl cis-trans isomerase, cyclophilin-type family protein [Zea mays] gi|224034643|gb|ACN36397.1| unknown [Zea mays] gi|224035785|gb|ACN36968.1| unknown [Zea mays] gi|414864301|tpg|DAA42858.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Zea mays] gi|414864302|tpg|DAA42859.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Zea mays] gi|414864303|tpg|DAA42860.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein isoform 3 [Zea mays] gi|414864304|tpg|DAA42861.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein isoform 4 [Zea mays] gi|414864305|tpg|DAA42862.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein isoform 5 [Zea mays] gi|414864306|tpg|DAA42863.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein isoform 6 [Zea mays] Length = 319 Score = 69.7 bits (169), Expect = 4e-10 Identities = 33/48 (68%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -1 Query: 146 DTTVTDRVFLDFSICPAYFLS-RTLGESDLSRCAESEPLGRVVLGLYG 6 DTT+TDR+F+DFS+CP+YF S R LG ++LS C +SEPLGRVV GLYG Sbjct: 80 DTTITDRIFMDFSVCPSYFRSDRPLG-AELSSCPDSEPLGRVVFGLYG 126 >ref|XP_006848823.1| hypothetical protein AMTR_s00026p00161370 [Amborella trichopoda] gi|548852256|gb|ERN10404.1| hypothetical protein AMTR_s00026p00161370 [Amborella trichopoda] Length = 336 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = -1 Query: 146 DTTVTDRVFLDFSICPAYFLSRTLGESDLSRCAESEPLGRVVLGLYG 6 DTT+TDRVF+DFS+CP+YF E DL C++ E LGRVVLGLYG Sbjct: 99 DTTITDRVFMDFSVCPSYFRPERTAEEDLPACSDLELLGRVVLGLYG 145 >gb|EMS67885.1| Peptidyl-prolyl cis-trans isomerase B [Triticum urartu] Length = 431 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/48 (66%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -1 Query: 146 DTTVTDRVFLDFSICPAYFLS-RTLGESDLSRCAESEPLGRVVLGLYG 6 DTT+TDR+F+DFSICP++F + RTLG ++L+ C +SEPLGRVV GLYG Sbjct: 151 DTTITDRIFMDFSICPSFFSNDRTLG-AELASCPDSEPLGRVVFGLYG 197 >ref|XP_007202379.1| hypothetical protein PRUPE_ppa009354mg [Prunus persica] gi|462397910|gb|EMJ03578.1| hypothetical protein PRUPE_ppa009354mg [Prunus persica] Length = 296 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -1 Query: 149 PDTTVTDRVFLDFSICPAYFLSRTLGESDLSRCAESEPLGRVVLGLYGN 3 PDTT+TDRVF+DFS+CP YF + +S + C +S PLGR+VLGLYG+ Sbjct: 58 PDTTITDRVFMDFSLCPTYFRPLSSADSKPTLCPDSVPLGRLVLGLYGH 106 >ref|XP_003573666.1| PREDICTED: peptidyl-prolyl cis-trans isomerase B1-like [Brachypodium distachyon] Length = 329 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/48 (70%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = -1 Query: 146 DTTVTDRVFLDFSICPAYFLS-RTLGESDLSRCAESEPLGRVVLGLYG 6 DTT+TDRVF+DFSICP+YF S RTLG + L+ C +SE LGRVV GLYG Sbjct: 90 DTTITDRVFMDFSICPSYFSSERTLG-AKLASCPDSETLGRVVFGLYG 136 >ref|NP_198360.2| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|3047064|gb|AAC13578.1| contains similarity to peptidyl-prolyl cis-trans isomerase (Pfam: pro_isomerase.hmm, score: 23.86 and 28.41 [Arabidopsis thaliana] gi|10176809|dbj|BAB10017.1| unnamed protein product [Arabidopsis thaliana] gi|51536584|gb|AAU05530.1| At5g35100 [Arabidopsis thaliana] gi|332006547|gb|AED93930.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] Length = 281 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 149 PDTTVTDRVFLDFSICPAYFLSRTLGE-SDLSRCAESEPLGRVVLGLYG 6 PD T+TDRVFLDFS+CP YF S S + C++S PLGRVVLGLYG Sbjct: 37 PDITITDRVFLDFSLCPTYFRSDPSATLSSTTPCSDSTPLGRVVLGLYG 85 >ref|XP_006395974.1| hypothetical protein EUTSA_v10004727mg [Eutrema salsugineum] gi|557092613|gb|ESQ33260.1| hypothetical protein EUTSA_v10004727mg [Eutrema salsugineum] Length = 285 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 149 PDTTVTDRVFLDFSICPAYFLSRTLGE-SDLSRCAESEPLGRVVLGLYG 6 PD T+TDRVFLDFS+CP YF S S + C++S PLGRVVLGLYG Sbjct: 41 PDITITDRVFLDFSLCPTYFRSDPSATLSSTTPCSDSTPLGRVVLGLYG 89 >ref|XP_006284284.1| hypothetical protein CARUB_v10005453mg [Capsella rubella] gi|482552989|gb|EOA17182.1| hypothetical protein CARUB_v10005453mg [Capsella rubella] Length = 277 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 149 PDTTVTDRVFLDFSICPAYFLSRTLGE-SDLSRCAESEPLGRVVLGLYG 6 PD T+TDRVFLDFS+CP YF S S + C++S PLGRVVLGLYG Sbjct: 42 PDITITDRVFLDFSLCPTYFRSDPSATLSSTTPCSDSTPLGRVVLGLYG 90 >ref|XP_002870416.1| peptidyl-prolyl cis-trans isomerase [Arabidopsis lyrata subsp. lyrata] gi|297316252|gb|EFH46675.1| peptidyl-prolyl cis-trans isomerase [Arabidopsis lyrata subsp. lyrata] Length = 281 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 149 PDTTVTDRVFLDFSICPAYFLSRTLGE-SDLSRCAESEPLGRVVLGLYG 6 PD T+TDRVFLDFS+CP YF S S + C++S PLGRVVLGLYG Sbjct: 37 PDITITDRVFLDFSLCPTYFRSDPSATLSSTTPCSDSTPLGRVVLGLYG 85 >ref|NP_001078636.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] gi|332006548|gb|AED93931.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein [Arabidopsis thaliana] Length = 245 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/49 (63%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = -1 Query: 149 PDTTVTDRVFLDFSICPAYFLSRTLGE-SDLSRCAESEPLGRVVLGLYG 6 PD T+TDRVFLDFS+CP YF S S + C++S PLGRVVLGLYG Sbjct: 37 PDITITDRVFLDFSLCPTYFRSDPSATLSSTTPCSDSTPLGRVVLGLYG 85