BLASTX nr result
ID: Mentha22_contig00021802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00021802 (573 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59475.1| hypothetical protein M569_15332, partial [Genlise... 57 3e-06 gb|EYU35935.1| hypothetical protein MIMGU_mgv1a000126mg [Mimulus... 57 4e-06 >gb|EPS59475.1| hypothetical protein M569_15332, partial [Genlisea aurea] Length = 164 Score = 57.4 bits (137), Expect = 3e-06 Identities = 34/57 (59%), Positives = 35/57 (61%), Gaps = 12/57 (21%) Frame = -2 Query: 527 GTWLPDPNSSGILGPPPSESSGRQFSNGRNYGMQQ------------SRPGFSSGIK 393 GTWLPD SGILGPPPS GRQF NGR Y MQQ SR GFSSG+K Sbjct: 113 GTWLPD---SGILGPPPS--GGRQFGNGRPYRMQQQQQQQQQQPGFSSRQGFSSGVK 164 >gb|EYU35935.1| hypothetical protein MIMGU_mgv1a000126mg [Mimulus guttatus] Length = 1709 Score = 56.6 bits (135), Expect = 4e-06 Identities = 31/50 (62%), Positives = 32/50 (64%), Gaps = 5/50 (10%) Frame = -2 Query: 527 GTWLPDPNSSGILGPPPSESSGRQFSNGRNYGMQQS-----RPGFSSGIK 393 G WLPD +SSGILGPPP GRQFSNGR Y Q R GFSS IK Sbjct: 1661 GAWLPDSHSSGILGPPP-PPDGRQFSNGRPYRAQPQAGFPPRQGFSSSIK 1709