BLASTX nr result
ID: Mentha22_contig00021752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00021752 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321011.2| hypothetical protein POPTR_0014s12500g [Popu... 81 1e-13 gb|EXC51716.1| ABC transporter C family member 4 [Morus notabilis] 80 3e-13 ref|XP_006359383.1| PREDICTED: ABC transporter C family member 4... 80 3e-13 ref|XP_004247427.1| PREDICTED: ABC transporter C family member 4... 80 3e-13 gb|EPS57775.1| hypothetical protein M569_17043, partial [Genlise... 79 5e-13 ref|XP_002301476.1| glutathione-conjugate transporter family pro... 79 7e-13 gb|EYU46678.1| hypothetical protein MIMGU_mgv1a000168mg [Mimulus... 78 1e-12 ref|XP_003553650.1| PREDICTED: ABC transporter C family member 4... 78 1e-12 ref|XP_007050897.1| Multidrug resistance-associated protein 4 is... 78 1e-12 ref|XP_006479939.1| PREDICTED: ABC transporter C family member 1... 77 2e-12 ref|XP_006444306.1| hypothetical protein CICLE_v10018482mg [Citr... 77 2e-12 ref|XP_002523063.1| multidrug resistance-associated protein 2, 6... 77 2e-12 ref|XP_004171957.1| PREDICTED: ABC transporter C family member 4... 77 3e-12 ref|XP_004136033.1| PREDICTED: ABC transporter C family member 4... 77 3e-12 ref|XP_007163104.1| hypothetical protein PHAVU_001G206600g [Phas... 77 3e-12 ref|XP_003536885.1| PREDICTED: ABC transporter C family member 1... 77 3e-12 emb|CBI36841.3| unnamed protein product [Vitis vinifera] 77 3e-12 ref|XP_002265012.1| PREDICTED: ABC transporter C family member 4... 77 3e-12 gb|AAX21200.1| putative protein [Phormium cookianum] 76 4e-12 ref|XP_002446124.1| hypothetical protein SORBIDRAFT_06g002080 [S... 76 6e-12 >ref|XP_002321011.2| hypothetical protein POPTR_0014s12500g [Populus trichocarpa] gi|550324065|gb|EEE99326.2| hypothetical protein POPTR_0014s12500g [Populus trichocarpa] Length = 1507 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLV+DAGR KEFDKPSRLL+RPSLFGALV+EYANRS+EL Sbjct: 1465 DCDRVLVIDAGRSKEFDKPSRLLERPSLFGALVREYANRSAEL 1507 >gb|EXC51716.1| ABC transporter C family member 4 [Morus notabilis] Length = 1507 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLVVDAGR KEFDKPSRL++RPS FGALVQEYANRSS L Sbjct: 1465 DCDRVLVVDAGRAKEFDKPSRLIERPSFFGALVQEYANRSSGL 1507 >ref|XP_006359383.1| PREDICTED: ABC transporter C family member 4-like [Solanum tuberosum] Length = 1513 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLVVDAG KEFDKPS LL+RPSLFGALVQEYANRSSEL Sbjct: 1471 DCDRVLVVDAGIAKEFDKPSHLLERPSLFGALVQEYANRSSEL 1513 >ref|XP_004247427.1| PREDICTED: ABC transporter C family member 4-like [Solanum lycopersicum] Length = 1513 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLVVDAG KEFDKPS LL+RPSLFGALVQEYANRSSEL Sbjct: 1471 DCDRVLVVDAGIAKEFDKPSHLLERPSLFGALVQEYANRSSEL 1513 >gb|EPS57775.1| hypothetical protein M569_17043, partial [Genlisea aurea] Length = 134 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLVVDAGR KEFD P+RLL+RPSLF ALVQEYANRSSEL Sbjct: 92 DCDRVLVVDAGRAKEFDTPARLLERPSLFAALVQEYANRSSEL 134 >ref|XP_002301476.1| glutathione-conjugate transporter family protein [Populus trichocarpa] gi|222843202|gb|EEE80749.1| glutathione-conjugate transporter family protein [Populus trichocarpa] Length = 1508 Score = 79.0 bits (193), Expect = 7e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLVVDAGR KEFDKPSRLL+RPSLFGALVQEYA RS+ L Sbjct: 1466 DCDRVLVVDAGRAKEFDKPSRLLERPSLFGALVQEYATRSAGL 1508 >gb|EYU46678.1| hypothetical protein MIMGU_mgv1a000168mg [Mimulus guttatus] Length = 1506 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCD+VLV+DAG+ KEFDKP LL+RPSLFGALVQEYANRSSEL Sbjct: 1464 DCDKVLVIDAGKAKEFDKPLHLLERPSLFGALVQEYANRSSEL 1506 >ref|XP_003553650.1| PREDICTED: ABC transporter C family member 4-like [Glycine max] Length = 1504 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLVVDAGR KEFDKPS LL R SLFGALVQEYANRS+EL Sbjct: 1462 DCDRVLVVDAGRAKEFDKPSNLLQRQSLFGALVQEYANRSTEL 1504 >ref|XP_007050897.1| Multidrug resistance-associated protein 4 isoform 1 [Theobroma cacao] gi|508703158|gb|EOX95054.1| Multidrug resistance-associated protein 4 isoform 1 [Theobroma cacao] Length = 1509 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLVVDAGR KEFDKPSRLL+RP+LF ALVQEYANRS+ L Sbjct: 1467 DCDRVLVVDAGRAKEFDKPSRLLERPTLFAALVQEYANRSAGL 1509 >ref|XP_006479939.1| PREDICTED: ABC transporter C family member 14-like isoform X1 [Citrus sinensis] gi|568852555|ref|XP_006479940.1| PREDICTED: ABC transporter C family member 14-like isoform X2 [Citrus sinensis] Length = 1510 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRV+VVDAG KEF KPSRLL+RPSLFGALVQEYANRS+EL Sbjct: 1468 DCDRVIVVDAGWAKEFGKPSRLLERPSLFGALVQEYANRSAEL 1510 >ref|XP_006444306.1| hypothetical protein CICLE_v10018482mg [Citrus clementina] gi|557546568|gb|ESR57546.1| hypothetical protein CICLE_v10018482mg [Citrus clementina] Length = 1510 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRV+VVDAG KEF KPSRLL+RPSLFGALVQEYANRS+EL Sbjct: 1468 DCDRVIVVDAGWAKEFGKPSRLLERPSLFGALVQEYANRSAEL 1510 >ref|XP_002523063.1| multidrug resistance-associated protein 2, 6 (mrp2, 6), abc-transoprter, putative [Ricinus communis] gi|223537625|gb|EEF39248.1| multidrug resistance-associated protein 2, 6 (mrp2, 6), abc-transoprter, putative [Ricinus communis] Length = 1506 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLV+DAG+ KEFDKPSRLL+RPSLF ALVQEYANRS+ L Sbjct: 1464 DCDRVLVIDAGKAKEFDKPSRLLERPSLFAALVQEYANRSAGL 1506 >ref|XP_004171957.1| PREDICTED: ABC transporter C family member 4-like [Cucumis sativus] Length = 254 Score = 77.0 bits (188), Expect = 3e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLV+DAG KEFDKPSRLL++PSLFG LVQEYANRS++L Sbjct: 212 DCDRVLVIDAGLAKEFDKPSRLLEKPSLFGGLVQEYANRSTDL 254 >ref|XP_004136033.1| PREDICTED: ABC transporter C family member 4-like [Cucumis sativus] Length = 1495 Score = 77.0 bits (188), Expect = 3e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLV+DAG KEFDKPSRLL++PSLFG LVQEYANRS++L Sbjct: 1453 DCDRVLVIDAGLAKEFDKPSRLLEKPSLFGGLVQEYANRSTDL 1495 >ref|XP_007163104.1| hypothetical protein PHAVU_001G206600g [Phaseolus vulgaris] gi|561036568|gb|ESW35098.1| hypothetical protein PHAVU_001G206600g [Phaseolus vulgaris] Length = 1190 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLVVDAGR KEFDKPS LL R SLFGALV+EYANRS+EL Sbjct: 1148 DCDRVLVVDAGRAKEFDKPSNLLQRQSLFGALVKEYANRSTEL 1190 >ref|XP_003536885.1| PREDICTED: ABC transporter C family member 14-like isoform X1 [Glycine max] gi|571481230|ref|XP_006588591.1| PREDICTED: ABC transporter C family member 14-like isoform X2 [Glycine max] gi|571481232|ref|XP_006588592.1| PREDICTED: ABC transporter C family member 14-like isoform X3 [Glycine max] gi|571481234|ref|XP_006588593.1| PREDICTED: ABC transporter C family member 14-like isoform X4 [Glycine max] gi|571481236|ref|XP_006588594.1| PREDICTED: ABC transporter C family member 14-like isoform X5 [Glycine max] Length = 1501 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLVVDAGR KEFD P+ LL RPSLFGALVQEYANRSS L Sbjct: 1459 DCDRVLVVDAGRAKEFDSPANLLQRPSLFGALVQEYANRSSGL 1501 >emb|CBI36841.3| unnamed protein product [Vitis vinifera] Length = 1079 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSS 260 DCDRVLV+DAGR KEFDKPSRLL+R SLFGALVQEYANRS+ Sbjct: 1037 DCDRVLVIDAGRAKEFDKPSRLLERHSLFGALVQEYANRSA 1077 >ref|XP_002265012.1| PREDICTED: ABC transporter C family member 4-like [Vitis vinifera] Length = 1509 Score = 76.6 bits (187), Expect = 3e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSS 260 DCDRVLV+DAGR KEFDKPSRLL+R SLFGALVQEYANRS+ Sbjct: 1467 DCDRVLVIDAGRAKEFDKPSRLLERHSLFGALVQEYANRSA 1507 >gb|AAX21200.1| putative protein [Phormium cookianum] Length = 94 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLV+DAG KEFDKPS L++RPSLFGALVQEY NRSS+L Sbjct: 52 DCDRVLVIDAGLAKEFDKPSNLIERPSLFGALVQEYLNRSSDL 94 >ref|XP_002446124.1| hypothetical protein SORBIDRAFT_06g002080 [Sorghum bicolor] gi|241937307|gb|EES10452.1| hypothetical protein SORBIDRAFT_06g002080 [Sorghum bicolor] Length = 1549 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -3 Query: 382 DCDRVLVVDAGRVKEFDKPSRLLDRPSLFGALVQEYANRSSEL 254 DCDRVLV+DAG VKEFD PSRL+++PSLFGA+VQEYANRSS L Sbjct: 1507 DCDRVLVLDAGLVKEFDSPSRLIEQPSLFGAMVQEYANRSSSL 1549