BLASTX nr result
ID: Mentha22_contig00021149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00021149 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39636.1| hypothetical protein MIMGU_mgv1a016601mg [Mimulus... 63 5e-08 >gb|EYU39636.1| hypothetical protein MIMGU_mgv1a016601mg [Mimulus guttatus] Length = 115 Score = 62.8 bits (151), Expect = 5e-08 Identities = 39/86 (45%), Positives = 44/86 (51%), Gaps = 14/86 (16%) Frame = -1 Query: 303 SSEIEATAIXXXXXXXXXXSIVHSFGSQNSAVDISDSISC--------------ISNQDN 166 SSEI + SI H F Q A DIS+ S ISNQ+N Sbjct: 30 SSEIGTREVSNDFIMAPSNSINHGFNPQGYAADISNQESNLMNHGFNSQEYAADISNQEN 89 Query: 165 IFEDILNELLPPSSANSGTWQFTGKL 88 IFEDI+NELLPPS +NSGTW F KL Sbjct: 90 IFEDIMNELLPPSGSNSGTWHFAEKL 115