BLASTX nr result
ID: Mentha22_contig00021014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00021014 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19793.1| hypothetical protein MIMGU_mgv1a005002mg [Mimulus... 57 2e-06 >gb|EYU19793.1| hypothetical protein MIMGU_mgv1a005002mg [Mimulus guttatus] Length = 501 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/51 (64%), Positives = 39/51 (76%), Gaps = 3/51 (5%) Frame = -3 Query: 380 VGSNLEL---GFSKKGASFRFYHVKTASQLRLNDIPHLLAEYKEFLSSTNI 237 +G LEL GF K A FRF HVK+ASQLR+++IP+LLAEYKE LSST I Sbjct: 448 LGCKLELADSGFRGKDA-FRFCHVKSASQLRMSEIPNLLAEYKELLSSTGI 497