BLASTX nr result
ID: Mentha22_contig00019917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00019917 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22265.1| hypothetical protein MIMGU_mgv1a006748mg [Mimulus... 57 3e-06 >gb|EYU22265.1| hypothetical protein MIMGU_mgv1a006748mg [Mimulus guttatus] Length = 433 Score = 57.0 bits (136), Expect = 3e-06 Identities = 36/86 (41%), Positives = 49/86 (56%), Gaps = 2/86 (2%) Frame = +3 Query: 72 MIRSLFFNSASFCGPPIIS-VNNKQLSSVRGRRHHQITHSSYNPTATDYSTKSEVSMDSM 248 M+ F S PI + +N+ +L S + +SY+ TAT+ S K +VSMDS Sbjct: 1 MLCCKFLGSTPLSSSPITTTINSAKLFSDK--------KTSYHCTATNCSIKPDVSMDSA 52 Query: 249 PKAH-DSAFEFLSKEPYVPPSWAANL 323 K H FEFLSK+ Y+PPSWAA+L Sbjct: 53 AKTHAPPTFEFLSKKTYIPPSWAAHL 78