BLASTX nr result
ID: Mentha22_contig00019830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00019830 (415 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34119.1| hypothetical protein MIMGU_mgv1a006718mg [Mimulus... 57 2e-06 >gb|EYU34119.1| hypothetical protein MIMGU_mgv1a006718mg [Mimulus guttatus] Length = 434 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/61 (50%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = -1 Query: 220 HPNKMERKWIFPLAIGXXXXXXXXXXXXXXSPDGVPIFPLRRYY--XXXXXXXXSIFVES 47 HP K+E+KWIFPLAIG SPDG P+FPLRRYY SIFVES Sbjct: 13 HPQKLEKKWIFPLAIGSIVSLFILFLTTLTSPDGTPLFPLRRYYSSSSAAAASASIFVES 72 Query: 46 R 44 + Sbjct: 73 K 73