BLASTX nr result
ID: Mentha22_contig00019613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00019613 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17498.1| hypothetical protein MIMGU_mgv1a002335mg [Mimulus... 80 3e-13 ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containi... 74 2e-11 ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 ref|XP_004500882.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citr... 72 1e-10 ref|XP_007018011.1| Pentatricopeptide repeat (PPR-like) superfam... 70 3e-10 ref|XP_007018010.1| Pentatricopeptide repeat (PPR-like) superfam... 70 3e-10 ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_006473770.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_004144287.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 ref|XP_003527377.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_003523110.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Popu... 69 9e-10 ref|XP_002510663.1| pentatricopeptide repeat-containing protein,... 68 1e-09 ref|XP_002272226.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 emb|CAN83144.1| hypothetical protein VITISV_040783 [Vitis vinifera] 68 1e-09 dbj|BAB10204.1| maize crp1 protein-like [Arabidopsis thaliana] 67 2e-09 ref|XP_006405260.1| hypothetical protein EUTSA_v10027665mg [Eutr... 67 2e-09 ref|XP_006279580.1| hypothetical protein CARUB_v10025981mg [Caps... 67 2e-09 >gb|EYU17498.1| hypothetical protein MIMGU_mgv1a002335mg [Mimulus guttatus] Length = 687 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALKL 304 +KYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKS LKL Sbjct: 647 EKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSTLKL 687 >ref|XP_004244963.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] Length = 699 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALKL 304 +K+E+VPAV+EEMLLSGC PDRKARAMLRSALRYMKS LKL Sbjct: 659 EKFERVPAVYEEMLLSGCIPDRKARAMLRSALRYMKSTLKL 699 >ref|XP_006346695.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum tuberosum] Length = 697 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALKL 304 +K+E+VPAV+EEMLL GC PDRKARAMLRSALRYMKS LKL Sbjct: 657 EKFERVPAVYEEMLLCGCIPDRKARAMLRSALRYMKSTLKL 697 >ref|XP_004500883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Cicer arietinum] Length = 691 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 DKY KVPAV+EEM++SGCAPDRKARAMLRSALRYMK L+ Sbjct: 651 DKYPKVPAVYEEMVMSGCAPDRKARAMLRSALRYMKQTLR 690 >ref|XP_004500882.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Cicer arietinum] Length = 720 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 DKY KVPAV+EEM++SGCAPDRKARAMLRSALRYMK L+ Sbjct: 680 DKYPKVPAVYEEMVMSGCAPDRKARAMLRSALRYMKQTLR 719 >ref|XP_006435342.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|567885569|ref|XP_006435343.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537464|gb|ESR48582.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] gi|557537465|gb|ESR48583.1| hypothetical protein CICLE_v10000451mg [Citrus clementina] Length = 704 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 DK+ KVPAV+EEM+LSGC PDRKARAMLRSALRYMK LK Sbjct: 664 DKFHKVPAVYEEMILSGCTPDRKARAMLRSALRYMKQTLK 703 >ref|XP_007018011.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 2, partial [Theobroma cacao] gi|508723339|gb|EOY15236.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 2, partial [Theobroma cacao] Length = 698 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 DK+ KVPAV+EEM+LSGC PDRKARAMLRSALRYMK +K Sbjct: 658 DKFHKVPAVYEEMILSGCTPDRKARAMLRSALRYMKQKVK 697 >ref|XP_007018010.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508723338|gb|EOY15235.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] Length = 703 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 DK+ KVPAV+EEM+LSGC PDRKARAMLRSALRYMK +K Sbjct: 663 DKFHKVPAVYEEMILSGCTPDRKARAMLRSALRYMKQKVK 702 >ref|XP_006473771.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Citrus sinensis] gi|568839606|ref|XP_006473772.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Citrus sinensis] Length = 99 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 DK+ KVPAV+EEM+ SGC PDRKARAMLRSALRYMK LK Sbjct: 59 DKFHKVPAVYEEMISSGCTPDRKARAMLRSALRYMKQTLK 98 >ref|XP_006473770.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Citrus sinensis] Length = 704 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 DK+ KVPAV+EEM+ SGC PDRKARAMLRSALRYMK LK Sbjct: 664 DKFHKVPAVYEEMISSGCTPDRKARAMLRSALRYMKQTLK 703 >ref|XP_004144287.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Cucumis sativus] gi|449489420|ref|XP_004158306.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Cucumis sativus] Length = 720 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALKL 304 DK++KVPAV+EEM+LSGC PD KARAMLRSALRYMK L L Sbjct: 680 DKFDKVPAVYEEMILSGCTPDGKARAMLRSALRYMKRTLSL 720 >ref|XP_003527377.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Glycine max] Length = 696 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 +K++KVPAV+EEM+ SGC PDRKARAMLRSALRYMK LK Sbjct: 656 EKFQKVPAVYEEMVTSGCTPDRKARAMLRSALRYMKQTLK 695 >ref|XP_003523110.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Glycine max] Length = 680 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 +K++KVPAV+EEM+ SGC PDRKARAMLRSALRYMK LK Sbjct: 640 EKFQKVPAVYEEMVASGCTPDRKARAMLRSALRYMKQTLK 679 >ref|XP_002306972.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] gi|222856421|gb|EEE93968.1| hypothetical protein POPTR_0005s27160g [Populus trichocarpa] Length = 709 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALKL 304 +K++KVP+V+EEM+LSGC PDRKARAMLRSAL+YMK L+L Sbjct: 669 EKFDKVPSVYEEMILSGCTPDRKARAMLRSALKYMKQTLEL 709 >ref|XP_002510663.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551364|gb|EEF52850.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 695 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALKL 304 DK+ KVP+V+EEM+L+GC PDRKARAMLRSAL+YMK L L Sbjct: 655 DKFNKVPSVYEEMILAGCTPDRKARAMLRSALKYMKQTLNL 695 >ref|XP_002272226.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial [Vitis vinifera] gi|297745544|emb|CBI40709.3| unnamed protein product [Vitis vinifera] Length = 695 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 +K++KVPAV+EEM LSGC PDRKARAMLRSALRYM+ LK Sbjct: 655 EKFDKVPAVYEEMTLSGCTPDRKARAMLRSALRYMERTLK 694 >emb|CAN83144.1| hypothetical protein VITISV_040783 [Vitis vinifera] Length = 724 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 +K++KVPAV+EEM LSGC PDRKARAMLRSALRYM+ LK Sbjct: 684 EKFDKVPAVYEEMTLSGCTPDRKARAMLRSALRYMERTLK 723 >dbj|BAB10204.1| maize crp1 protein-like [Arabidopsis thaliana] Length = 680 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 DK++KVP V+EEM++SGC PDRKAR+MLRSALRYMK L+ Sbjct: 639 DKFQKVPVVYEEMIMSGCKPDRKARSMLRSALRYMKQTLR 678 >ref|XP_006405260.1| hypothetical protein EUTSA_v10027665mg [Eutrema salsugineum] gi|557106398|gb|ESQ46713.1| hypothetical protein EUTSA_v10027665mg [Eutrema salsugineum] Length = 704 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 DK++KVP V+EEM++SGC PDRKAR+MLRSALRYMK L+ Sbjct: 663 DKFQKVPGVYEEMIMSGCKPDRKARSMLRSALRYMKQTLR 702 >ref|XP_006279580.1| hypothetical protein CARUB_v10025981mg [Capsella rubella] gi|482548284|gb|EOA12478.1| hypothetical protein CARUB_v10025981mg [Capsella rubella] Length = 708 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 426 DKYEKVPAVFEEMLLSGCAPDRKARAMLRSALRYMKSALK 307 DK++KVP V+EEM++SGC PDRKAR+MLRSALRYMK L+ Sbjct: 667 DKFQKVPGVYEEMIMSGCKPDRKARSMLRSALRYMKQTLR 706