BLASTX nr result
ID: Mentha22_contig00018946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00018946 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43787.1| hypothetical protein MIMGU_mgv1a022633mg, partial... 57 4e-06 >gb|EYU43787.1| hypothetical protein MIMGU_mgv1a022633mg, partial [Mimulus guttatus] Length = 640 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +3 Query: 3 LRILQCDGSHSFNTKESSVPDDNMVEVPTYALEG 104 LRILQCD SHSFNT+ SS PDDNM E TYALEG Sbjct: 607 LRILQCDISHSFNTEASSGPDDNMFEAQTYALEG 640