BLASTX nr result
ID: Mentha22_contig00018900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00018900 (553 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237977.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-14 gb|EYU27007.1| hypothetical protein MIMGU_mgv1a005508mg [Mimulus... 54 9e-14 emb|CAN80524.1| hypothetical protein VITISV_030537 [Vitis vinifera] 55 2e-13 ref|XP_002283907.2| PREDICTED: pentatricopeptide repeat-containi... 55 2e-13 ref|XP_006338085.1| PREDICTED: pentatricopeptide repeat-containi... 52 9e-13 ref|XP_004136259.1| PREDICTED: pentatricopeptide repeat-containi... 48 2e-11 ref|XP_002301082.1| hypothetical protein POPTR_0002s10380g [Popu... 55 3e-11 ref|XP_003602939.1| Pentatricopeptide repeat-containing protein ... 51 5e-11 ref|XP_004301354.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 51 6e-11 gb|EXC16677.1| hypothetical protein L484_007723 [Morus notabilis] 55 8e-11 ref|XP_006433856.1| hypothetical protein CICLE_v10000867mg [Citr... 53 1e-10 ref|XP_002532248.1| pentatricopeptide repeat-containing protein,... 54 2e-10 ref|XP_003527867.1| PREDICTED: pentatricopeptide repeat-containi... 50 8e-10 ref|XP_006472504.1| PREDICTED: pentatricopeptide repeat-containi... 53 1e-09 ref|XP_004501623.1| PREDICTED: pentatricopeptide repeat-containi... 49 3e-09 ref|XP_007015425.1| Pentatricopeptide repeat superfamily protein... 51 6e-09 ref|XP_007223320.1| hypothetical protein PRUPE_ppa009514mg [Prun... 46 7e-09 ref|XP_006841227.1| hypothetical protein AMTR_s00135p00057260 [A... 40 9e-07 ref|XP_006287559.1| hypothetical protein CARUB_v10000770mg [Caps... 43 3e-06 ref|NP_974803.1| pentatricopeptide repeat-containing protein [Ar... 41 3e-06 >ref|XP_004237977.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Solanum lycopersicum] Length = 511 Score = 54.7 bits (130), Expect(2) = 5e-14 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSNEL+V LCE G D LFGL+EMGFKP+P TW + Sbjct: 449 TSNELIVQLCEAGKAADAALALFGLLEMGFKPEPQTWSM 487 Score = 48.5 bits (114), Expect(2) = 5e-14 Identities = 20/27 (74%), Positives = 26/27 (96%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLLMQ 357 WS +ID+ICRERKLLPAF+LLD+L++Q Sbjct: 485 WSMLIDVICRERKLLPAFQLLDELVLQ 511 >gb|EYU27007.1| hypothetical protein MIMGU_mgv1a005508mg [Mimulus guttatus] Length = 481 Score = 53.5 bits (127), Expect(2) = 9e-14 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTW 442 TSNELLV LCE G N +LFGLVE GFKP+P TW Sbjct: 419 TSNELLVSLCEAGNANGAGLVLFGLVETGFKPEPGTW 455 Score = 48.9 bits (115), Expect(2) = 9e-14 Identities = 22/28 (78%), Positives = 25/28 (89%) Frame = -3 Query: 443 GGWSSIIDLICRERKLLPAFELLDKLLM 360 G WS +IDLICRERKLLPAF+LLD L+M Sbjct: 453 GTWSVLIDLICRERKLLPAFQLLDGLVM 480 >emb|CAN80524.1| hypothetical protein VITISV_030537 [Vitis vinifera] Length = 714 Score = 55.1 bits (131), Expect(2) = 2e-13 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSNELLV LCE G V D V L GL+E+GFKP+P +W L Sbjct: 492 TSNELLVHLCEAGKVGDAVMALLGLLELGFKPEPNSWAL 530 Score = 46.2 bits (108), Expect(2) = 2e-13 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLLMQ 357 W+ +++LICRERKLLPAFELLD L++Q Sbjct: 528 WALLVELICRERKLLPAFELLDDLVIQ 554 >ref|XP_002283907.2| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Vitis vinifera] Length = 513 Score = 55.1 bits (131), Expect(2) = 2e-13 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSNELLV LCE G V D V L GL+E+GFKP+P +W L Sbjct: 449 TSNELLVHLCEAGKVGDAVMALLGLLELGFKPEPNSWAL 487 Score = 46.2 bits (108), Expect(2) = 2e-13 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLLMQ 357 W+ +++LICRERKLLPAFELLD L++Q Sbjct: 485 WALLVELICRERKLLPAFELLDDLVIQ 511 >ref|XP_006338085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Solanum tuberosum] Length = 511 Score = 52.4 bits (124), Expect(2) = 9e-13 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSNEL+V LCE G D LFGL+EM FKP+P TW + Sbjct: 449 TSNELIVQLCEAGKAADAALALFGLLEMSFKPEPRTWSM 487 Score = 46.6 bits (109), Expect(2) = 9e-13 Identities = 19/26 (73%), Positives = 25/26 (96%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLLM 360 WS +ID+ICRERKLLPAF+LLD+L++ Sbjct: 485 WSMLIDVICRERKLLPAFQLLDELVL 510 >ref|XP_004136259.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Cucumis sativus] gi|449497032|ref|XP_004160294.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Cucumis sativus] Length = 504 Score = 48.1 bits (113), Expect(2) = 2e-11 Identities = 22/37 (59%), Positives = 26/37 (70%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTW 442 TSN LL+ LC GMV D V L GL+EMGFKP+ +W Sbjct: 439 TSNTLLLLLCNNGMVKDAVESLLGLLEMGFKPEHESW 475 Score = 46.6 bits (109), Expect(2) = 2e-11 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = -3 Query: 446 HGGWSSIIDLICRERKLLPAFELLDKLLMQ 357 H W +++DLICRERK+LP FELLD L+ Q Sbjct: 472 HESWFTLVDLICRERKMLPVFELLDVLVTQ 501 >ref|XP_002301082.1| hypothetical protein POPTR_0002s10380g [Populus trichocarpa] gi|222842808|gb|EEE80355.1| hypothetical protein POPTR_0002s10380g [Populus trichocarpa] Length = 509 Score = 55.5 bits (132), Expect(2) = 3e-11 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSNELLVGLC+ GM +D V L+GL EMGFKP+ +W L Sbjct: 439 TSNELLVGLCKAGMADDAVVALYGLAEMGFKPEQDSWAL 477 Score = 38.5 bits (88), Expect(2) = 3e-11 Identities = 15/24 (62%), Positives = 21/24 (87%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKL 366 W+ +++ +CRERKLL AFELLD+L Sbjct: 475 WALLVEFVCRERKLLLAFELLDEL 498 >ref|XP_003602939.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355491987|gb|AES73190.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 586 Score = 50.8 bits (120), Expect(2) = 5e-11 Identities = 23/39 (58%), Positives = 28/39 (71%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSNELLV LC++GM ND LF LV+MGF+P +W L Sbjct: 522 TSNELLVRLCKEGMANDAATALFDLVDMGFQPQHDSWEL 560 Score = 42.4 bits (98), Expect(2) = 5e-11 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -3 Query: 446 HGGWSSIIDLICRERKLLPAFELLDKLL 363 H W +IDLICR+RKLL FELLD+L+ Sbjct: 555 HDSWELLIDLICRDRKLLYVFELLDELV 582 >ref|XP_004301354.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g18475-like [Fragaria vesca subsp. vesca] Length = 568 Score = 50.8 bits (120), Expect(2) = 6e-11 Identities = 24/37 (64%), Positives = 27/37 (72%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTW 442 TSN LLV LCE GM++D LFGLVEMGFKP +W Sbjct: 503 TSNGLLVSLCEAGMIDDATTALFGLVEMGFKPLLDSW 539 Score = 42.0 bits (97), Expect(2) = 6e-11 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLL 363 W+ ++ ICRERKLLPAFELLD+L+ Sbjct: 539 WAXFVESICRERKLLPAFELLDELV 563 >gb|EXC16677.1| hypothetical protein L484_007723 [Morus notabilis] Length = 513 Score = 55.1 bits (131), Expect(2) = 8e-11 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSNELLV LC GM +D LFGL+EMGFKP+P +W + Sbjct: 452 TSNELLVRLCNAGMADDAAMALFGLLEMGFKPEPDSWAI 490 Score = 37.4 bits (85), Expect(2) = 8e-11 Identities = 15/25 (60%), Positives = 22/25 (88%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLL 363 W+ ++DLI RERKLL +F+LLD+L+ Sbjct: 488 WAILVDLISRERKLLSSFQLLDELI 512 >ref|XP_006433856.1| hypothetical protein CICLE_v10000867mg [Citrus clementina] gi|567882597|ref|XP_006433857.1| hypothetical protein CICLE_v10000867mg [Citrus clementina] gi|557535978|gb|ESR47096.1| hypothetical protein CICLE_v10000867mg [Citrus clementina] gi|557535979|gb|ESR47097.1| hypothetical protein CICLE_v10000867mg [Citrus clementina] Length = 521 Score = 53.1 bits (126), Expect(2) = 1e-10 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSNELLV LC+ GM D LFGLVEMGFKP+ +W L Sbjct: 451 TSNELLVRLCKAGMAEDAAIALFGLVEMGFKPESDSWAL 489 Score = 38.5 bits (88), Expect(2) = 1e-10 Identities = 16/27 (59%), Positives = 24/27 (88%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLLMQ 357 W+ +++LICR RKLL AFELLD+L+++ Sbjct: 487 WALLVELICRGRKLLFAFELLDELVIK 513 >ref|XP_002532248.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528066|gb|EEF30142.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 521 Score = 54.3 bits (129), Expect(2) = 2e-10 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTW 442 TSNELLV LCE GMV++ V LFGL +MGF P+P +W Sbjct: 448 TSNELLVCLCEAGMVDNAVTALFGLTQMGFTPEPKSW 484 Score = 36.6 bits (83), Expect(2) = 2e-10 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLL 363 W+ +I+ ICRERKLL FEL+D+L+ Sbjct: 484 WAHLIEYICRERKLLFVFELVDELV 508 >ref|XP_003527867.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like [Glycine max] Length = 546 Score = 49.7 bits (117), Expect(2) = 8e-10 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSNELLV LC+ GMV+D LF LVEMGF+P TW + Sbjct: 482 TSNELLVCLCKAGMVDDAAVALFDLVEMGFQPGLETWEV 520 Score = 39.3 bits (90), Expect(2) = 8e-10 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLLMQPT 351 W +I LICRERKLL FELLD+L++ T Sbjct: 518 WEVLIGLICRERKLLYVFELLDELVVTNT 546 >ref|XP_006472504.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like isoform X1 [Citrus sinensis] gi|568836969|ref|XP_006472505.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like isoform X2 [Citrus sinensis] Length = 521 Score = 53.1 bits (126), Expect(2) = 1e-09 Identities = 25/39 (64%), Positives = 28/39 (71%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSNELLV LC+ GM D LFGLVEMGFKP+ +W L Sbjct: 451 TSNELLVRLCKAGMAEDAAIALFGLVEMGFKPESDSWAL 489 Score = 35.0 bits (79), Expect(2) = 1e-09 Identities = 14/27 (51%), Positives = 23/27 (85%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLLMQ 357 W+ ++++ICR RKLL AF LLD+L+++ Sbjct: 487 WALLVEMICRGRKLLFAFVLLDELVIK 513 >ref|XP_004501623.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like isoform X1 [Cicer arietinum] gi|502133024|ref|XP_004501624.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18475-like isoform X2 [Cicer arietinum] Length = 510 Score = 48.9 bits (115), Expect(2) = 3e-09 Identities = 22/39 (56%), Positives = 27/39 (69%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSNELL+ C++GMV+D LF LVEMGF+P W L Sbjct: 446 TSNELLISFCKEGMVDDAAAALFDLVEMGFQPPLDCWEL 484 Score = 38.1 bits (87), Expect(2) = 3e-09 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLL 363 W +I+LICR+RKLL FELLD+L+ Sbjct: 482 WELLIELICRDRKLLYVFELLDELV 506 >ref|XP_007015425.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|590585358|ref|XP_007015426.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508785788|gb|EOY33044.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508785789|gb|EOY33045.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 530 Score = 50.8 bits (120), Expect(2) = 6e-09 Identities = 22/37 (59%), Positives = 27/37 (72%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTW 442 TSN+LL+ LC+ GMV+D V L GL E GFKP+P W Sbjct: 451 TSNDLLIRLCKAGMVDDAVTALVGLAETGFKPEPHCW 487 Score = 35.0 bits (79), Expect(2) = 6e-09 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLLMQ 357 W + +L C+ERKLL FELLD+L+++ Sbjct: 487 WEFLTELNCKERKLLSVFELLDELVIK 513 >ref|XP_007223320.1| hypothetical protein PRUPE_ppa009514mg [Prunus persica] gi|462420256|gb|EMJ24519.1| hypothetical protein PRUPE_ppa009514mg [Prunus persica] Length = 289 Score = 46.2 bits (108), Expect(2) = 7e-09 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWRL 436 TSN+LLV L E GM + V L LVEMGFKP P +W L Sbjct: 224 TSNDLLVRLSEAGMAENAVMALSRLVEMGFKPQPDSWAL 262 Score = 39.7 bits (91), Expect(2) = 7e-09 Identities = 16/26 (61%), Positives = 23/26 (88%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLLM 360 W+ +++ ICRERKLL AFELLD+L++ Sbjct: 260 WALLVESICRERKLLSAFELLDELVV 285 >ref|XP_006841227.1| hypothetical protein AMTR_s00135p00057260 [Amborella trichopoda] gi|548843143|gb|ERN02902.1| hypothetical protein AMTR_s00135p00057260 [Amborella trichopoda] Length = 514 Score = 40.4 bits (93), Expect(2) = 9e-07 Identities = 19/37 (51%), Positives = 25/37 (67%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTW 442 TSN+LLV L ++G V DGV+ L L+E G PD +W Sbjct: 433 TSNQLLVSLFKEGRVGDGVKALHNLLEKGVIPDSGSW 469 Score = 38.1 bits (87), Expect(2) = 9e-07 Identities = 16/34 (47%), Positives = 24/34 (70%) Frame = -3 Query: 443 GGWSSIIDLICRERKLLPAFELLDKLLMQPT*IL 342 G W+S ++ +C+ERK+L A ELLD +L T I+ Sbjct: 467 GSWASFVESVCKERKILRAVELLDDILDHRTEII 500 >ref|XP_006287559.1| hypothetical protein CARUB_v10000770mg [Capsella rubella] gi|565459122|ref|XP_006287560.1| hypothetical protein CARUB_v10000770mg [Capsella rubella] gi|482556265|gb|EOA20457.1| hypothetical protein CARUB_v10000770mg [Capsella rubella] gi|482556266|gb|EOA20458.1| hypothetical protein CARUB_v10000770mg [Capsella rubella] Length = 506 Score = 42.7 bits (99), Expect(2) = 3e-06 Identities = 18/38 (47%), Positives = 26/38 (68%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTWR 439 T NEL+V LC G GVR+L G +++G +P+P +WR Sbjct: 445 TWNELVVRLCGSGNAEMGVRVLIGFLKIGLQPEPSSWR 482 Score = 34.3 bits (77), Expect(2) = 3e-06 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLL 363 W ++++ CRERKL+ FELLD L+ Sbjct: 481 WRAVVESSCRERKLVHVFELLDSLV 505 >ref|NP_974803.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122214363|sp|Q3E9F0.1|PP392_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g18475 gi|110737103|dbj|BAF00503.1| hypothetical protein [Arabidopsis thaliana] gi|332005185|gb|AED92568.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 506 Score = 40.8 bits (94), Expect(2) = 3e-06 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = -2 Query: 552 TSNELLVGLCEKGMVNDGVRLLFGLVEMGFKPDPLTW 442 T NEL+V LCE G GVR+L G + +G P P +W Sbjct: 445 TWNELVVRLCESGYTEIGVRVLIGFLRIGLIPGPKSW 481 Score = 35.8 bits (81), Expect(2) = 3e-06 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = -3 Query: 437 WSSIIDLICRERKLLPAFELLDKLL 363 W ++++ IC+ERKL+ FELLD L+ Sbjct: 481 WGAVVESICKERKLVHVFELLDSLV 505