BLASTX nr result
ID: Mentha22_contig00018776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00018776 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46792.1| hypothetical protein MIMGU_mgv1a0099882mg, partia... 56 5e-06 >gb|EYU46792.1| hypothetical protein MIMGU_mgv1a0099882mg, partial [Mimulus guttatus] Length = 223 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +3 Query: 225 MAHRRSKLLLFLSFAVYCLVAIAAKSYYDVLQVPKGAS 338 MA RRSKLLL + F Y L+AIAAKSYYD+LQV KGAS Sbjct: 1 MAQRRSKLLLLVCFLSYYLIAIAAKSYYDILQVQKGAS 38