BLASTX nr result
ID: Mentha22_contig00018749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00018749 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27636.1| hypothetical protein MIMGU_mgv1a013241mg [Mimulus... 64 2e-08 ref|XP_006373574.1| hypothetical protein POPTR_0016s00520g [Popu... 60 3e-07 ref|XP_007026412.1| Calcineurin B-like protein 2 isoform 2 [Theo... 60 4e-07 ref|XP_007026411.1| Calcineurin B-like protein 2 isoform 1 [Theo... 60 4e-07 ref|XP_006467221.1| PREDICTED: calcineurin B-like protein 3-like... 59 9e-07 ref|XP_006467219.1| PREDICTED: calcineurin B-like protein 3-like... 59 9e-07 ref|XP_006449992.1| hypothetical protein CICLE_v10016575mg [Citr... 59 9e-07 gb|EXB64613.1| Calcineurin B-like protein 3 [Morus notabilis] 58 2e-06 ref|XP_004499340.1| PREDICTED: calcineurin B-like protein 3-like... 56 5e-06 ref|NP_001267977.1| uncharacterized protein LOC100262221 [Vitis ... 56 5e-06 ref|XP_007154070.1| hypothetical protein PHAVU_003G088500g [Phas... 56 6e-06 >gb|EYU27636.1| hypothetical protein MIMGU_mgv1a013241mg [Mimulus guttatus] Length = 226 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 207 MVQFLDGLKHLLSAIVSCCDSEIYKQPRGLDSPEAL 314 MVQ LDG+KHLLS+IV+CCDSEIYKQP GL++PEAL Sbjct: 1 MVQCLDGVKHLLSSIVNCCDSEIYKQPWGLENPEAL 36 >ref|XP_006373574.1| hypothetical protein POPTR_0016s00520g [Populus trichocarpa] gi|550320484|gb|ERP51371.1| hypothetical protein POPTR_0016s00520g [Populus trichocarpa] Length = 199 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +3 Query: 207 MVQFLDGLKHLLSAIVSCCDSEIYKQPRGLDSPEAL 314 MVQ LDGLKHL +AI +CCD+++YKQPRGL+ PE L Sbjct: 1 MVQCLDGLKHLCAAIANCCDADLYKQPRGLEDPEVL 36 >ref|XP_007026412.1| Calcineurin B-like protein 2 isoform 2 [Theobroma cacao] gi|508781778|gb|EOY29034.1| Calcineurin B-like protein 2 isoform 2 [Theobroma cacao] Length = 199 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = +3 Query: 207 MVQFLDGLKHLLSAIVSCCDSEIYKQPRGLDSPEAL 314 MVQ L+GLKHL +A+++CCD+++YKQP+GL+ PEAL Sbjct: 1 MVQCLEGLKHLCAAVINCCDADLYKQPKGLEDPEAL 36 >ref|XP_007026411.1| Calcineurin B-like protein 2 isoform 1 [Theobroma cacao] gi|508781777|gb|EOY29033.1| Calcineurin B-like protein 2 isoform 1 [Theobroma cacao] Length = 226 Score = 59.7 bits (143), Expect = 4e-07 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = +3 Query: 207 MVQFLDGLKHLLSAIVSCCDSEIYKQPRGLDSPEAL 314 MVQ L+GLKHL +A+++CCD+++YKQP+GL+ PEAL Sbjct: 1 MVQCLEGLKHLCAAVINCCDADLYKQPKGLEDPEAL 36 >ref|XP_006467221.1| PREDICTED: calcineurin B-like protein 3-like isoform X3 [Citrus sinensis] Length = 206 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 207 MVQFLDGLKHLLSAIVSCCDSEIYKQPRGLDSPEAL 314 MVQ LDGLKH +V+CCD+++YKQPRGL+ PEAL Sbjct: 1 MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEAL 36 >ref|XP_006467219.1| PREDICTED: calcineurin B-like protein 3-like isoform X1 [Citrus sinensis] gi|568825709|ref|XP_006467220.1| PREDICTED: calcineurin B-like protein 3-like isoform X2 [Citrus sinensis] Length = 226 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 207 MVQFLDGLKHLLSAIVSCCDSEIYKQPRGLDSPEAL 314 MVQ LDGLKH +V+CCD+++YKQPRGL+ PEAL Sbjct: 1 MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEAL 36 >ref|XP_006449992.1| hypothetical protein CICLE_v10016575mg [Citrus clementina] gi|557552603|gb|ESR63232.1| hypothetical protein CICLE_v10016575mg [Citrus clementina] Length = 226 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 207 MVQFLDGLKHLLSAIVSCCDSEIYKQPRGLDSPEAL 314 MVQ LDGLKH +V+CCD+++YKQPRGL+ PEAL Sbjct: 1 MVQCLDGLKHFCVVVVNCCDADLYKQPRGLEDPEAL 36 >gb|EXB64613.1| Calcineurin B-like protein 3 [Morus notabilis] Length = 500 Score = 57.8 bits (138), Expect = 2e-06 Identities = 21/36 (58%), Positives = 32/36 (88%) Frame = +3 Query: 207 MVQFLDGLKHLLSAIVSCCDSEIYKQPRGLDSPEAL 314 MVQFL+G+KHL A+++CCD+++Y+ P+GL+ PEAL Sbjct: 1 MVQFLEGIKHLCVAVINCCDADLYRHPKGLEDPEAL 36 >ref|XP_004499340.1| PREDICTED: calcineurin B-like protein 3-like [Cicer arietinum] Length = 226 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 207 MVQFLDGLKHLLSAIVSCCDSEIYKQPRGLDSPEAL 314 MVQ LDGLKHL +A+V+CC+S+ KQPRGL++PE L Sbjct: 1 MVQCLDGLKHLCAAVVNCCESDSIKQPRGLENPELL 36 >ref|NP_001267977.1| uncharacterized protein LOC100262221 [Vitis vinifera] gi|147770306|emb|CAN62487.1| hypothetical protein VITISV_029390 [Vitis vinifera] gi|229609883|gb|ACQ83557.1| calcineurin B-like protein 03 [Vitis vinifera] Length = 226 Score = 56.2 bits (134), Expect = 5e-06 Identities = 21/36 (58%), Positives = 32/36 (88%) Frame = +3 Query: 207 MVQFLDGLKHLLSAIVSCCDSEIYKQPRGLDSPEAL 314 M+Q L+G+KHL + +V+CCD+++YKQP+GL+ PEAL Sbjct: 1 MLQCLEGVKHLCAVVVNCCDADLYKQPKGLEDPEAL 36 >ref|XP_007154070.1| hypothetical protein PHAVU_003G088500g [Phaseolus vulgaris] gi|166788449|dbj|BAG06680.1| calcineurin B-like protein [Phaseolus vulgaris] gi|561027424|gb|ESW26064.1| hypothetical protein PHAVU_003G088500g [Phaseolus vulgaris] Length = 226 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 207 MVQFLDGLKHLLSAIVSCCDSEIYKQPRGLDSPEAL 314 MVQ LDGLKHL +A+V+CCD++ KQPRGL++PE L Sbjct: 1 MVQCLDGLKHLCAALVNCCDADSSKQPRGLENPELL 36