BLASTX nr result
ID: Mentha22_contig00018625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00018625 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32781.1| hypothetical protein MIMGU_mgv1a011028mg [Mimulus... 66 6e-09 >gb|EYU32781.1| hypothetical protein MIMGU_mgv1a011028mg [Mimulus guttatus] Length = 294 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/42 (78%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = +1 Query: 211 IMFFRKSNTS-HDGESVEQQHERKFQELKASLGPLSGRSLQY 333 +MFFRKS TS HDGES+E Q ERKF ELKASLGPLSGR+LQ+ Sbjct: 1 MMFFRKSTTSPHDGESLELQQERKFNELKASLGPLSGRNLQF 42