BLASTX nr result
ID: Mentha22_contig00018591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00018591 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002463292.1| hypothetical protein SORBIDRAFT_02g041370 [S... 56 5e-06 >ref|XP_002463292.1| hypothetical protein SORBIDRAFT_02g041370 [Sorghum bicolor] gi|241926669|gb|EER99813.1| hypothetical protein SORBIDRAFT_02g041370 [Sorghum bicolor] Length = 393 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/57 (47%), Positives = 34/57 (59%) Frame = -1 Query: 397 HPRAKGLYKTPFLLFDKLQLIYEGDRADGTRCEDMNDSINNMDVELENDLDDSGVTE 227 HPRAKGLY PF+ FD IY DR+ G E D+I NM+ E+ N++ D V E Sbjct: 121 HPRAKGLYGVPFVYFDTFDAIYGKDRSAGEGLEGSEDAIANMENEITNEVGDDEVEE 177