BLASTX nr result
ID: Mentha22_contig00018556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00018556 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28382.1| hypothetical protein MIMGU_mgv1a014660mg [Mimulus... 83 4e-14 ref|XP_006433150.1| hypothetical protein CICLE_v10002594mg [Citr... 82 6e-14 ref|XP_007030108.1| Ribosomal L.8/L5e family protein isoform 5 [... 82 6e-14 ref|XP_007030106.1| Ribosomal L.8/L5e family protein isoform 3 [... 82 6e-14 ref|XP_007030105.1| Ribosomal L.8/L5e family protein isoform 2 [... 82 6e-14 ref|XP_007030104.1| Ribosomal L.8/L5e family protein isoform 1 [... 82 6e-14 ref|XP_004139203.1| PREDICTED: uncharacterized protein LOC101215... 82 6e-14 ref|XP_002534606.1| structural constituent of ribosome, putative... 82 6e-14 ref|XP_002319579.1| hypothetical protein POPTR_0013s03030g [Popu... 82 6e-14 ref|XP_007148817.1| hypothetical protein PHAVU_005G016700g [Phas... 82 8e-14 ref|XP_007146178.1| hypothetical protein PHAVU_006G019000g [Phas... 82 8e-14 ref|XP_006843163.1| hypothetical protein AMTR_s00146p00051060 [A... 82 8e-14 gb|AGV54630.1| hypothetical protein [Phaseolus vulgaris] 82 8e-14 ref|XP_006350406.1| PREDICTED: uncharacterized protein LOC102578... 82 1e-13 gb|EXB67643.1| hypothetical protein L484_010209 [Morus notabilis] 81 1e-13 ref|XP_006364507.1| PREDICTED: uncharacterized protein LOC102596... 81 1e-13 ref|XP_004237377.1| PREDICTED: uncharacterized protein LOC101253... 81 1e-13 ref|XP_004237376.1| PREDICTED: uncharacterized protein LOC101253... 81 1e-13 ref|XP_004231063.1| PREDICTED: uncharacterized protein LOC101247... 81 1e-13 gb|AFK35404.1| unknown [Lotus japonicus] 81 1e-13 >gb|EYU28382.1| hypothetical protein MIMGU_mgv1a014660mg [Mimulus guttatus] Length = 182 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGIDIKIY Sbjct: 140 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 180 >ref|XP_006433150.1| hypothetical protein CICLE_v10002594mg [Citrus clementina] gi|568835543|ref|XP_006471827.1| PREDICTED: uncharacterized protein LOC102609549 [Citrus sinensis] gi|557535272|gb|ESR46390.1| hypothetical protein CICLE_v10002594mg [Citrus clementina] Length = 188 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGID+KIY Sbjct: 146 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDVKIY 186 >ref|XP_007030108.1| Ribosomal L.8/L5e family protein isoform 5 [Theobroma cacao] gi|508718713|gb|EOY10610.1| Ribosomal L.8/L5e family protein isoform 5 [Theobroma cacao] Length = 180 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGIDIK+Y Sbjct: 138 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDIKVY 178 >ref|XP_007030106.1| Ribosomal L.8/L5e family protein isoform 3 [Theobroma cacao] gi|590640994|ref|XP_007030107.1| Ribosomal L.8/L5e family protein isoform 3 [Theobroma cacao] gi|508718711|gb|EOY10608.1| Ribosomal L.8/L5e family protein isoform 3 [Theobroma cacao] gi|508718712|gb|EOY10609.1| Ribosomal L.8/L5e family protein isoform 3 [Theobroma cacao] Length = 188 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGIDIK+Y Sbjct: 146 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDIKVY 186 >ref|XP_007030105.1| Ribosomal L.8/L5e family protein isoform 2 [Theobroma cacao] gi|508718710|gb|EOY10607.1| Ribosomal L.8/L5e family protein isoform 2 [Theobroma cacao] Length = 192 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGIDIK+Y Sbjct: 150 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDIKVY 190 >ref|XP_007030104.1| Ribosomal L.8/L5e family protein isoform 1 [Theobroma cacao] gi|508718709|gb|EOY10606.1| Ribosomal L.8/L5e family protein isoform 1 [Theobroma cacao] Length = 203 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGIDIK+Y Sbjct: 161 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDIKVY 201 >ref|XP_004139203.1| PREDICTED: uncharacterized protein LOC101215592 [Cucumis sativus] gi|449525565|ref|XP_004169787.1| PREDICTED: uncharacterized LOC101215592 [Cucumis sativus] Length = 187 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGID+KIY Sbjct: 145 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDVKIY 185 >ref|XP_002534606.1| structural constituent of ribosome, putative [Ricinus communis] gi|223524931|gb|EEF27777.1| structural constituent of ribosome, putative [Ricinus communis] Length = 188 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGIDIK+Y Sbjct: 146 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDIKVY 186 >ref|XP_002319579.1| hypothetical protein POPTR_0013s03030g [Populus trichocarpa] gi|222857955|gb|EEE95502.1| hypothetical protein POPTR_0013s03030g [Populus trichocarpa] Length = 187 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGID+KIY Sbjct: 145 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDVKIY 185 >ref|XP_007148817.1| hypothetical protein PHAVU_005G016700g [Phaseolus vulgaris] gi|593696672|ref|XP_007148818.1| hypothetical protein PHAVU_005G016700g [Phaseolus vulgaris] gi|593696674|ref|XP_007148819.1| hypothetical protein PHAVU_005G016700g [Phaseolus vulgaris] gi|561022081|gb|ESW20811.1| hypothetical protein PHAVU_005G016700g [Phaseolus vulgaris] gi|561022082|gb|ESW20812.1| hypothetical protein PHAVU_005G016700g [Phaseolus vulgaris] gi|561022083|gb|ESW20813.1| hypothetical protein PHAVU_005G016700g [Phaseolus vulgaris] Length = 187 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGID+K+Y Sbjct: 145 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDVKVY 185 >ref|XP_007146178.1| hypothetical protein PHAVU_006G019000g [Phaseolus vulgaris] gi|593691219|ref|XP_007146179.1| hypothetical protein PHAVU_006G019000g [Phaseolus vulgaris] gi|561019401|gb|ESW18172.1| hypothetical protein PHAVU_006G019000g [Phaseolus vulgaris] gi|561019402|gb|ESW18173.1| hypothetical protein PHAVU_006G019000g [Phaseolus vulgaris] Length = 187 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGID+K+Y Sbjct: 145 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDVKVY 185 >ref|XP_006843163.1| hypothetical protein AMTR_s00146p00051060 [Amborella trichopoda] gi|548845387|gb|ERN04838.1| hypothetical protein AMTR_s00146p00051060 [Amborella trichopoda] Length = 149 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGID+K+Y Sbjct: 107 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDVKVY 147 >gb|AGV54630.1| hypothetical protein [Phaseolus vulgaris] Length = 187 Score = 82.0 bits (201), Expect = 8e-14 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPRERDKFEGKIRAVVQSLIDNGID+K+Y Sbjct: 145 RAREADVYTASYTPRERDKFEGKIRAVVQSLIDNGIDVKVY 185 >ref|XP_006350406.1| PREDICTED: uncharacterized protein LOC102578991 [Solanum tuberosum] Length = 182 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPR+RDKFEGKIRAVVQSLIDNGIDIKIY Sbjct: 140 RAREADVYTASYTPRDRDKFEGKIRAVVQSLIDNGIDIKIY 180 >gb|EXB67643.1| hypothetical protein L484_010209 [Morus notabilis] Length = 187 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPR+RDKFEGKIRAVVQSLIDNGID+KIY Sbjct: 145 RAREADVYTASYTPRDRDKFEGKIRAVVQSLIDNGIDVKIY 185 >ref|XP_006364507.1| PREDICTED: uncharacterized protein LOC102596304 [Solanum tuberosum] Length = 182 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPR+RDKFEGKIRAVVQSLIDNGIDIK+Y Sbjct: 140 RAREADVYTASYTPRDRDKFEGKIRAVVQSLIDNGIDIKVY 180 >ref|XP_004237377.1| PREDICTED: uncharacterized protein LOC101253374 isoform 2 [Solanum lycopersicum] Length = 175 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPR+RDKFEGKIRAVVQSLIDNGIDIK+Y Sbjct: 133 RAREADVYTASYTPRDRDKFEGKIRAVVQSLIDNGIDIKVY 173 >ref|XP_004237376.1| PREDICTED: uncharacterized protein LOC101253374 isoform 1 [Solanum lycopersicum] Length = 182 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPR+RDKFEGKIRAVVQSLIDNGIDIK+Y Sbjct: 140 RAREADVYTASYTPRDRDKFEGKIRAVVQSLIDNGIDIKVY 180 >ref|XP_004231063.1| PREDICTED: uncharacterized protein LOC101247077 [Solanum lycopersicum] Length = 202 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPR+RDKFEGKIRAVVQSLIDNGIDIK+Y Sbjct: 160 RAREADVYTASYTPRDRDKFEGKIRAVVQSLIDNGIDIKVY 200 >gb|AFK35404.1| unknown [Lotus japonicus] Length = 148 Score = 81.3 bits (199), Expect = 1e-13 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 317 RAREADVYTAAYTPRERDKFEGKIRAVVQSLIDNGIDIKIY 195 RAREADVYTA+YTPR+RDKFEGKIRAVVQSLIDNGIDIK+Y Sbjct: 106 RAREADVYTASYTPRDRDKFEGKIRAVVQSLIDNGIDIKVY 146