BLASTX nr result
ID: Mentha22_contig00018554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00018554 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44859.1| hypothetical protein MIMGU_mgv1a010507mg [Mimulus... 68 1e-09 gb|EYU34785.1| hypothetical protein MIMGU_mgv1a010488mg [Mimulus... 68 1e-09 gb|EYU24669.1| hypothetical protein MIMGU_mgv1a010224mg [Mimulus... 68 1e-09 gb|EYU24668.1| hypothetical protein MIMGU_mgv1a010224mg [Mimulus... 68 1e-09 gb|EPS67732.1| hypothetical protein M569_07040, partial [Genlise... 68 2e-09 ref|XP_004304000.1| PREDICTED: cytochrome c1-1, heme protein, mi... 68 2e-09 ref|XP_006465389.1| PREDICTED: cytochrome c1-1, heme protein, mi... 67 2e-09 ref|XP_006427182.1| hypothetical protein CICLE_v10026079mg [Citr... 67 2e-09 gb|AAX20004.1| putative cytochrome c1 precursor protein [Ornitho... 67 3e-09 ref|XP_006478166.1| PREDICTED: cytochrome c1-1, heme protein, mi... 67 3e-09 ref|XP_006441506.1| hypothetical protein CICLE_v10023388mg [Citr... 67 3e-09 ref|XP_007023943.1| Cytochrome c1-1, heme protein, mitochondrial... 67 3e-09 ref|XP_006384824.1| hypothetical protein POPTR_0004s21400g [Popu... 65 8e-09 ref|XP_007215730.1| hypothetical protein PRUPE_ppa009069mg [Prun... 65 8e-09 ref|XP_004133751.1| PREDICTED: cytochrome c1-1, heme protein, mi... 65 8e-09 ref|XP_002313590.1| cytochrome c1 family protein [Populus tricho... 65 8e-09 ref|XP_006384826.1| cytochrome c1 family protein [Populus tricho... 65 8e-09 emb|CBI36255.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002285312.1| PREDICTED: cytochrome c1-1, heme protein, mi... 65 1e-08 ref|XP_006645294.1| PREDICTED: cytochrome c1-1, heme protein, mi... 64 2e-08 >gb|EYU44859.1| hypothetical protein MIMGU_mgv1a010507mg [Mimulus guttatus] Length = 310 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWILVLSLA +QAGYYRRL+WSV KSRKLVLDV+N Sbjct: 275 FKWILVLSLALLQAGYYRRLRWSVLKSRKLVLDVVN 310 >gb|EYU34785.1| hypothetical protein MIMGU_mgv1a010488mg [Mimulus guttatus] gi|604329455|gb|EYU34786.1| hypothetical protein MIMGU_mgv1a010488mg [Mimulus guttatus] Length = 310 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWILVLSLA +QAGYYRRL+WSV KSRKLVLDV+N Sbjct: 275 FKWILVLSLALLQAGYYRRLRWSVLKSRKLVLDVVN 310 >gb|EYU24669.1| hypothetical protein MIMGU_mgv1a010224mg [Mimulus guttatus] Length = 314 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWILVLSLA +QAGYYRRL+WSV KSRKLVLDV+N Sbjct: 279 FKWILVLSLALLQAGYYRRLRWSVLKSRKLVLDVVN 314 >gb|EYU24668.1| hypothetical protein MIMGU_mgv1a010224mg [Mimulus guttatus] Length = 318 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWILVLSLA +QAGYYRRL+WSV KSRKLVLDV+N Sbjct: 283 FKWILVLSLALLQAGYYRRLRWSVLKSRKLVLDVVN 318 >gb|EPS67732.1| hypothetical protein M569_07040, partial [Genlisea aurea] Length = 272 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWILVLSLA +QAGYYRR++WSV KSRKLVLDVIN Sbjct: 237 FKWILVLSLALLQAGYYRRMRWSVLKSRKLVLDVIN 272 >ref|XP_004304000.1| PREDICTED: cytochrome c1-1, heme protein, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 307 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QAGYYRRLKWSV KSRKLVLDV+N Sbjct: 272 FKWIFVLSLALLQAGYYRRLKWSVLKSRKLVLDVVN 307 >ref|XP_006465389.1| PREDICTED: cytochrome c1-1, heme protein, mitochondrial-like [Citrus sinensis] Length = 323 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QAGYYRRLKWSV KSRKL+LDV+N Sbjct: 288 FKWIFVLSLALLQAGYYRRLKWSVLKSRKLILDVVN 323 >ref|XP_006427182.1| hypothetical protein CICLE_v10026079mg [Citrus clementina] gi|557529172|gb|ESR40422.1| hypothetical protein CICLE_v10026079mg [Citrus clementina] Length = 323 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QAGYYRRLKWSV KSRKL+LDV+N Sbjct: 288 FKWIFVLSLALLQAGYYRRLKWSVLKSRKLILDVVN 323 >gb|AAX20004.1| putative cytochrome c1 precursor protein [Ornithogalum virens] Length = 185 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QAGYYRRL+WSV+KSRKLV+DV+N Sbjct: 150 FKWIFVLSLALLQAGYYRRLRWSVFKSRKLVVDVVN 185 >ref|XP_006478166.1| PREDICTED: cytochrome c1-1, heme protein, mitochondrial-like [Citrus sinensis] Length = 310 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QAGYYRRL+WSV KSRKLVLDV+N Sbjct: 275 FKWIFVLSLALLQAGYYRRLRWSVLKSRKLVLDVVN 310 >ref|XP_006441506.1| hypothetical protein CICLE_v10023388mg [Citrus clementina] gi|557543768|gb|ESR54746.1| hypothetical protein CICLE_v10023388mg [Citrus clementina] Length = 310 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QAGYYRRL+WSV KSRKLVLDV+N Sbjct: 275 FKWIFVLSLALLQAGYYRRLRWSVLKSRKLVLDVVN 310 >ref|XP_007023943.1| Cytochrome c1-1, heme protein, mitochondrial isoform 1 [Theobroma cacao] gi|508779309|gb|EOY26565.1| Cytochrome c1-1, heme protein, mitochondrial isoform 1 [Theobroma cacao] Length = 321 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QA YYRRLKWS++KSRKLVLDV+N Sbjct: 286 FKWIFVLSLALLQAAYYRRLKWSIFKSRKLVLDVVN 321 >ref|XP_006384824.1| hypothetical protein POPTR_0004s21400g [Populus trichocarpa] gi|550341592|gb|ERP62621.1| hypothetical protein POPTR_0004s21400g [Populus trichocarpa] Length = 343 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QA YYRRLKWSV KSRKLVLDV+N Sbjct: 308 FKWIFVLSLALLQAAYYRRLKWSVLKSRKLVLDVVN 343 >ref|XP_007215730.1| hypothetical protein PRUPE_ppa009069mg [Prunus persica] gi|462411880|gb|EMJ16929.1| hypothetical protein PRUPE_ppa009069mg [Prunus persica] Length = 307 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QA YYRRLKWSV KSRKLVLDV+N Sbjct: 272 FKWIFVLSLALLQAAYYRRLKWSVLKSRKLVLDVVN 307 >ref|XP_004133751.1| PREDICTED: cytochrome c1-1, heme protein, mitochondrial-like [Cucumis sativus] gi|449478083|ref|XP_004155217.1| PREDICTED: cytochrome c1-1, heme protein, mitochondrial-like [Cucumis sativus] Length = 307 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QA YYRRLKWSV KSRKLVLDV+N Sbjct: 272 FKWIFVLSLALLQAAYYRRLKWSVLKSRKLVLDVVN 307 >ref|XP_002313590.1| cytochrome c1 family protein [Populus trichocarpa] gi|222849998|gb|EEE87545.1| cytochrome c1 family protein [Populus trichocarpa] Length = 310 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QA YYRRLKWSV KSRKLVLDV+N Sbjct: 275 FKWIFVLSLALLQAAYYRRLKWSVLKSRKLVLDVVN 310 >ref|XP_006384826.1| cytochrome c1 family protein [Populus trichocarpa] gi|118485601|gb|ABK94651.1| unknown [Populus trichocarpa] gi|550341594|gb|ERP62623.1| cytochrome c1 family protein [Populus trichocarpa] Length = 310 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QA YYRRLKWSV KSRKLVLDV+N Sbjct: 275 FKWIFVLSLALLQAAYYRRLKWSVLKSRKLVLDVVN 310 >emb|CBI36255.3| unnamed protein product [Vitis vinifera] Length = 316 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QA YYRRLKWS++KSRKL++DV+N Sbjct: 281 FKWIFVLSLALLQAAYYRRLKWSIFKSRKLIVDVVN 316 >ref|XP_002285312.1| PREDICTED: cytochrome c1-1, heme protein, mitochondrial-like [Vitis vinifera] Length = 325 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -3 Query: 328 FKWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 FKWI VLSLA +QA YYRRLKWS++KSRKL++DV+N Sbjct: 290 FKWIFVLSLALLQAAYYRRLKWSIFKSRKLIVDVVN 325 >ref|XP_006645294.1| PREDICTED: cytochrome c1-1, heme protein, mitochondrial-like [Oryza brachyantha] Length = 304 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -3 Query: 325 KWILVLSLAFIQAGYYRRLKWSVYKSRKLVLDVIN 221 KWI +LSLA +QA YYRR+KWSVYKSRKLVLDV+N Sbjct: 270 KWIFLLSLALLQAAYYRRMKWSVYKSRKLVLDVVN 304