BLASTX nr result
ID: Mentha22_contig00018362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00018362 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007222168.1| hypothetical protein PRUPE_ppa005814mg [Prun... 56 6e-06 >ref|XP_007222168.1| hypothetical protein PRUPE_ppa005814mg [Prunus persica] gi|462419104|gb|EMJ23367.1| hypothetical protein PRUPE_ppa005814mg [Prunus persica] Length = 442 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = +3 Query: 3 KNDQQRSLQMIQHWKTMYDNLHQFCVDELLE 95 K+D +RS+QM+Q WK MYDNLHQFCV+ELL+ Sbjct: 400 KHDYERSIQMVQQWKKMYDNLHQFCVNELLD 430