BLASTX nr result
ID: Mentha22_contig00018233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00018233 (525 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESO89640.1| hypothetical protein LOTGIDRAFT_164944 [Lottia gi... 68 1e-18 ref|XP_003389266.1| PREDICTED: u6 snRNA-associated Sm-like prote... 67 1e-18 ref|XP_002732802.1| PREDICTED: U6 snRNA-associated Sm-like prote... 67 2e-18 ref|XP_002590808.1| hypothetical protein BRAFLDRAFT_125735 [Bran... 67 2e-18 ref|XP_005044800.1| PREDICTED: U6 snRNA-associated Sm-like prote... 67 3e-18 ref|XP_005014761.1| PREDICTED: uncharacterized protein LOC101800... 66 4e-18 ref|XP_005356151.1| PREDICTED: U6 snRNA-associated Sm-like prote... 66 4e-18 gb|AFK10840.1| U6 snRNA-associated Sm-like protein LSm6 [Callorh... 66 4e-18 ref|NP_009011.1| U6 snRNA-associated Sm-like protein LSm6 [Homo ... 66 5e-18 ref|XP_006023779.1| PREDICTED: U6 snRNA-associated Sm-like prote... 66 5e-18 ref|XP_005995598.1| PREDICTED: U6 snRNA-associated Sm-like prote... 66 5e-18 ref|XP_005284336.1| PREDICTED: U6 snRNA-associated Sm-like prote... 66 5e-18 ref|XP_005284335.1| PREDICTED: U6 snRNA-associated Sm-like prote... 66 5e-18 ref|XP_005243372.1| PREDICTED: U6 snRNA-associated Sm-like prote... 66 5e-18 ref|XP_004941025.1| PREDICTED: U6 snRNA-associated Sm-like prote... 66 5e-18 ref|XP_004645495.1| PREDICTED: U6 snRNA-associated Sm-like prote... 66 5e-18 ref|XP_004456556.1| PREDICTED: U6 snRNA-associated Sm-like prote... 66 5e-18 ref|XP_003928047.1| PREDICTED: U6 snRNA-associated Sm-like prote... 66 5e-18 gb|EKC33396.1| Nucleolar protein 6 [Crassostrea gigas] 65 6e-18 ref|XP_005883121.1| PREDICTED: U6 snRNA-associated Sm-like prote... 66 6e-18 >gb|ESO89640.1| hypothetical protein LOTGIDRAFT_164944 [Lottia gigantea] Length = 79 Score = 67.8 bits (164), Expect(2) = 1e-18 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 182 LSGTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +S +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 1 MSNKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 40 Score = 50.8 bits (120), Expect(2) = 1e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 53 GQLKNKYGDAFIRGNNVLYISTQK 76 >ref|XP_003389266.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm6-like [Amphimedon queenslandica] Length = 80 Score = 67.4 bits (163), Expect(2) = 1e-18 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +2 Query: 182 LSGTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +S +TP DFLK I GRPVVVKLNSGVDYRGILACLDG M Sbjct: 1 MSRKRTPNDFLKQIAGRPVVVKLNSGVDYRGILACLDGYM 40 Score = 51.2 bits (121), Expect(2) = 1e-18 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST+K Sbjct: 53 GQLKNKYGDAFIRGNNVLYISTTK 76 >ref|XP_002732802.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Saccoglossus kowalevskii] Length = 79 Score = 67.0 bits (162), Expect(2) = 2e-18 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 182 LSGTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +S +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 1 MSRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 40 Score = 50.8 bits (120), Expect(2) = 2e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 53 GQLKNKYGDAFIRGNNVLYISTQK 76 >ref|XP_002590808.1| hypothetical protein BRAFLDRAFT_125735 [Branchiostoma floridae] gi|229276005|gb|EEN46819.1| hypothetical protein BRAFLDRAFT_125735 [Branchiostoma floridae] Length = 81 Score = 67.0 bits (162), Expect(2) = 2e-18 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 182 LSGTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +S +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 1 MSRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 40 Score = 50.8 bits (120), Expect(2) = 2e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 53 GQLKNKYGDAFIRGNNVLYISTQK 76 >ref|XP_005044800.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Ficedula albicollis] Length = 103 Score = 66.6 bits (161), Expect(2) = 3e-18 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +2 Query: 146 NQFGRMSGSGEKLSGTK-TPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 N+ G + K+S K TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 12 NEVGTVLPEKIKMSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 64 Score = 50.8 bits (120), Expect(2) = 3e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 77 GQLKNKYGDAFIRGNNVLYISTQK 100 >ref|XP_005014761.1| PREDICTED: uncharacterized protein LOC101800680 [Anas platyrhynchos] Length = 200 Score = 66.2 bits (160), Expect(2) = 4e-18 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = +2 Query: 155 GRMSGSGEKLSGTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 G +G+ E+ +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 116 GHEAGACER---KQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 161 Score = 50.8 bits (120), Expect(2) = 4e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 174 GQLKNKYGDAFIRGNNVLYISTQK 197 >ref|XP_005356151.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Microtus ochrogaster] Length = 93 Score = 66.2 bits (160), Expect(2) = 4e-18 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXMAN*RTNT 322 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M R +T Sbjct: 6 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIAREHT 48 Score = 50.8 bits (120), Expect(2) = 4e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 54 GQLKNKYGDAFIRGNNVLYISTQK 77 >gb|AFK10840.1| U6 snRNA-associated Sm-like protein LSm6 [Callorhinchus milii] Length = 80 Score = 65.9 bits (159), Expect(2) = 4e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 6 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 41 Score = 51.2 bits (121), Expect(2) = 4e-18 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSKGTL 381 GQLKNKYGDAFIRGNNVLYIST K L Sbjct: 54 GQLKNKYGDAFIRGNNVLYISTQKRRL 80 >ref|NP_009011.1| U6 snRNA-associated Sm-like protein LSm6 [Homo sapiens] gi|113865835|ref|NP_084421.1| U6 snRNA-associated Sm-like protein LSm6 [Mus musculus] gi|148234781|ref|NP_001087318.1| Sm protein F [Xenopus laevis] gi|167583548|ref|NP_001107991.1| U6 snRNA-associated Sm-like protein LSm6 [Bos taurus] gi|186910275|ref|NP_001119557.1| U6 snRNA-associated Sm-like protein LSm6 [Rattus norvegicus] gi|284172395|ref|NP_001165068.1| Sm protein F [Xenopus (Silurana) tropicalis] gi|300797601|ref|NP_001177933.1| U6 snRNA-associated Sm-like protein LSm6 [Mus musculus] gi|350536543|ref|NP_001232484.1| putative LSM6 homolog U6 small nuclear RNA associated [Taeniopygia guttata] gi|388454641|ref|NP_001253894.1| U6 snRNA-associated Sm-like protein LSm6 [Macaca mulatta] gi|118089868|ref|XP_420431.2| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoformX2 [Gallus gallus] gi|149637763|ref|XP_001510547.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Ornithorhynchus anatinus] gi|291401158|ref|XP_002716966.1| PREDICTED: Sm protein F [Oryctolagus cuniculus] gi|293352714|ref|XP_002728048.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Rattus norvegicus] gi|296195455|ref|XP_002745354.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform 1 [Callithrix jacchus] gi|297674437|ref|XP_002815234.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pongo abelii] gi|301761728|ref|XP_002916283.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm6-like isoform 1 [Ailuropoda melanoleuca] gi|301761730|ref|XP_002916284.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm6-like isoform 2 [Ailuropoda melanoleuca] gi|326918386|ref|XP_003205470.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm6-like [Meleagris gallopavo] gi|327273948|ref|XP_003221741.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm6-like [Anolis carolinensis] gi|332217354|ref|XP_003257824.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 1 [Nomascus leucogenys] gi|332217356|ref|XP_003257825.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 2 [Nomascus leucogenys] gi|332217358|ref|XP_003257826.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 3 [Nomascus leucogenys] gi|332820272|ref|XP_003310523.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 1 [Pan troglodytes] gi|332820274|ref|XP_003339112.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pan troglodytes] gi|332820276|ref|XP_003310524.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 2 [Pan troglodytes] gi|332820278|ref|XP_003310526.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 4 [Pan troglodytes] gi|332820280|ref|XP_003310527.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 5 [Pan troglodytes] gi|335293789|ref|XP_003357054.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Sus scrofa] gi|338722510|ref|XP_003364554.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Equus caballus] gi|344291754|ref|XP_003417595.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Loxodonta africana] gi|345781166|ref|XP_855162.2| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 2 [Canis lupus familiaris] gi|345781168|ref|XP_003432092.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 1 [Canis lupus familiaris] gi|348582250|ref|XP_003476889.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Cavia porcellus] gi|354477192|ref|XP_003500806.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Cricetulus griseus] gi|390460377|ref|XP_003732476.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform 2 [Callithrix jacchus] gi|392332759|ref|XP_003752686.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Rattus norvegicus] gi|395542575|ref|XP_003773202.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Sarcophilus harrisii] gi|395834523|ref|XP_003790249.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Otolemur garnettii] gi|397489777|ref|XP_003815894.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pan paniscus] gi|402870580|ref|XP_003899290.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 1 [Papio anubis] gi|402870582|ref|XP_003899291.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 2 [Papio anubis] gi|410038770|ref|XP_003950473.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pan troglodytes] gi|410038772|ref|XP_003950474.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pan troglodytes] gi|410956783|ref|XP_003985017.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Felis catus] gi|426246981|ref|XP_004017265.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Ovis aries] gi|426345621|ref|XP_004040503.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 1 [Gorilla gorilla gorilla] gi|426345623|ref|XP_004040504.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 2 [Gorilla gorilla gorilla] gi|426345625|ref|XP_004040505.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 3 [Gorilla gorilla gorilla] gi|426345627|ref|XP_004040506.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 4 [Gorilla gorilla gorilla] gi|426345629|ref|XP_004040507.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 5 [Gorilla gorilla gorilla] gi|426345631|ref|XP_004040508.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 6 [Gorilla gorilla gorilla] gi|441619228|ref|XP_004088560.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Nomascus leucogenys] gi|465972508|ref|XP_004263659.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 1 [Orcinus orca] gi|465972556|ref|XP_004263660.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform 2 [Orcinus orca] gi|471382231|ref|XP_004378901.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Trichechus manatus latirostris] gi|472384897|ref|XP_004411815.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Odobenus rosmarus divergens] gi|478493178|ref|XP_004420944.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Ceratotherium simum simum] gi|505792777|ref|XP_004606250.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Sorex araneus] gi|507543833|ref|XP_004655900.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Jaculus jaculus] gi|507671097|ref|XP_004708757.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Echinops telfairi] gi|511876157|ref|XP_004758073.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Mustela putorius furo] gi|511876159|ref|XP_004758074.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Mustela putorius furo] gi|511968408|ref|XP_004802286.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Mustela putorius furo] gi|512934585|ref|XP_004907694.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X3 [Heterocephalus glaber] gi|513015276|ref|XP_004868978.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Heterocephalus glaber] gi|513182216|ref|XP_004941026.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X4 [Gallus gallus] gi|514474419|ref|XP_005006841.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Cavia porcellus] gi|524955636|ref|XP_005077791.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Mesocricetus auratus] gi|527256699|ref|XP_005146622.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Melopsittacus undulatus] gi|530580897|ref|XP_005284337.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X3 [Chrysemys picta bellii] gi|530580899|ref|XP_005284338.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X4 [Chrysemys picta bellii] gi|532002362|ref|XP_005345438.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform X1 [Microtus ochrogaster] gi|532002364|ref|XP_005345439.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform X2 [Microtus ochrogaster] gi|532002366|ref|XP_005345440.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform X3 [Microtus ochrogaster] gi|532083727|ref|XP_005327601.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Ictidomys tridecemlineatus] gi|533144384|ref|XP_005386718.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Chinchilla lanigera] gi|533144386|ref|XP_005386719.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Chinchilla lanigera] gi|542152984|ref|XP_005485374.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Zonotrichia albicollis] gi|543251756|ref|XP_005418158.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Geospiza fortis] gi|543364586|ref|XP_005525655.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Pseudopodoces humilis] gi|543364588|ref|XP_005525656.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Pseudopodoces humilis] gi|543717342|ref|XP_005499923.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Columba livia] gi|544434946|ref|XP_005556078.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Macaca fascicularis] gi|544434948|ref|XP_005556079.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Macaca fascicularis] gi|544434950|ref|XP_005556080.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X3 [Macaca fascicularis] gi|544434952|ref|XP_005556081.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X4 [Macaca fascicularis] gi|545845721|ref|XP_005666900.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X4 [Sus scrofa] gi|545845723|ref|XP_005666901.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X5 [Sus scrofa] gi|545845725|ref|XP_005666902.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X6 [Sus scrofa] gi|545845727|ref|XP_005666903.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X7 [Sus scrofa] gi|545845729|ref|XP_005666904.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X8 [Sus scrofa] gi|548499946|ref|XP_005691262.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Capra hircus] gi|556760303|ref|XP_005975471.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Pantholops hodgsonii] gi|556760305|ref|XP_005975472.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Pantholops hodgsonii] gi|556976231|ref|XP_005995599.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Latimeria chalumnae] gi|556976234|ref|XP_005995600.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X3 [Latimeria chalumnae] gi|556976237|ref|XP_005995601.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X4 [Latimeria chalumnae] gi|557281658|ref|XP_006023780.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Alligator sinensis] gi|558098227|ref|XP_006081812.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Myotis lucifugus] gi|558098229|ref|XP_006081813.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Myotis lucifugus] gi|558211974|ref|XP_006133902.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pelodiscus sinensis] gi|560922170|ref|XP_006187285.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Camelus ferus] gi|560975375|ref|XP_006209989.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Vicugna pacos] gi|562827827|ref|XP_006143521.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform X1 [Tupaia chinensis] gi|562827829|ref|XP_006143522.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform X2 [Tupaia chinensis] gi|564259330|ref|XP_006268590.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Alligator mississippiensis] gi|564259332|ref|XP_006268591.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Alligator mississippiensis] gi|564395325|ref|XP_006255470.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Rattus norvegicus] gi|584071002|ref|XP_006755821.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Myotis davidii] gi|585201381|ref|XP_006751607.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform X1 [Leptonychotes weddellii] gi|585201383|ref|XP_006751608.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform X2 [Leptonychotes weddellii] gi|585663222|ref|XP_006887063.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Elephantulus edwardii] gi|586483665|ref|XP_006872338.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Chrysochloris asiatica] gi|586542416|ref|XP_006906345.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Pteropus alecto] gi|586983927|ref|XP_006930901.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Felis catus] gi|586983930|ref|XP_006930902.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X3 [Felis catus] gi|589916942|ref|XP_006971787.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Peromyscus maniculatus bairdii] gi|591332115|ref|XP_007091821.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Panthera tigris altaica] gi|591332117|ref|XP_007091822.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Panthera tigris altaica] gi|591332119|ref|XP_007091823.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X3 [Panthera tigris altaica] gi|591361713|ref|XP_007055771.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Chelonia mydas] gi|593764468|ref|XP_007120814.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform X1 [Physeter catodon] gi|593764470|ref|XP_007120815.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform X2 [Physeter catodon] gi|594084433|ref|XP_006065774.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Bubalus bubalis] gi|594084435|ref|XP_006065775.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Bubalus bubalis] gi|594683796|ref|XP_007189439.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Balaenoptera acutorostrata scammoni] gi|594683798|ref|XP_007189440.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Balaenoptera acutorostrata scammoni] gi|594683800|ref|XP_007189441.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X3 [Balaenoptera acutorostrata scammoni] gi|594683802|ref|XP_007189442.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X4 [Balaenoptera acutorostrata scammoni] gi|602656098|ref|XP_007433786.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Python bivittatus] gi|602656100|ref|XP_007433787.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Python bivittatus] gi|602723849|ref|XP_007472061.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Lipotes vexillifer] gi|612031060|ref|XP_001376922.3| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Monodelphis domestica] gi|617551133|ref|XP_007528283.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Erinaceus europaeus] gi|61227727|sp|P62312.1|LSM6_HUMAN RecName: Full=U6 snRNA-associated Sm-like protein LSm6 gi|61227728|sp|P62313.1|LSM6_MOUSE RecName: Full=U6 snRNA-associated Sm-like protein LSm6 gi|5919153|gb|AAD56230.1|AF182292_1 U6 snRNA-associated Sm-like protein LSm6 [Homo sapiens] gi|5262862|emb|CAB45869.1| Lsm6 protein [Homo sapiens] gi|12859166|dbj|BAB31555.1| unnamed protein product [Mus musculus] gi|16359118|gb|AAH16026.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Homo sapiens] gi|20987896|gb|AAH30427.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Mus musculus] gi|26347205|dbj|BAC37251.1| unnamed protein product [Mus musculus] gi|51593502|gb|AAH78551.1| MGC85411 protein [Xenopus laevis] gi|63995242|gb|AAY41032.1| unknown [Homo sapiens] gi|67514294|gb|AAH98230.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Mus musculus] gi|68534470|gb|AAH99484.1| Lsm6 protein [Mus musculus] gi|74179952|dbj|BAE36530.1| unnamed protein product [Mus musculus] gi|74196623|dbj|BAE34418.1| unnamed protein product [Mus musculus] gi|74202626|dbj|BAE24870.1| unnamed protein product [Mus musculus] gi|109939818|gb|AAI18349.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Bos taurus] gi|110645766|gb|AAI18890.1| MGC147213 protein [Xenopus (Silurana) tropicalis] gi|119226360|gb|AAI28976.1| MGC85411 protein [Xenopus laevis] gi|119625434|gb|EAX05029.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), isoform CRA_a [Homo sapiens] gi|119625435|gb|EAX05030.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), isoform CRA_a [Homo sapiens] gi|119625436|gb|EAX05031.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae), isoform CRA_a [Homo sapiens] gi|123983026|gb|ABM83254.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [synthetic construct] gi|148678915|gb|EDL10862.1| mCG7981, isoform CRA_a [Mus musculus] gi|148678917|gb|EDL10864.1| mCG7981, isoform CRA_a [Mus musculus] gi|149037959|gb|EDL92319.1| rCG51654, isoform CRA_a [Rattus norvegicus] gi|149037960|gb|EDL92320.1| rCG51654, isoform CRA_a [Rattus norvegicus] gi|149037961|gb|EDL92321.1| rCG51654, isoform CRA_a [Rattus norvegicus] gi|149058701|gb|EDM09858.1| rCG63582, isoform CRA_b [Rattus norvegicus] gi|157928024|gb|ABW03308.1| LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [synthetic construct] gi|163916395|gb|AAI57145.1| MGC147213 protein [Xenopus (Silurana) tropicalis] gi|189053256|dbj|BAG35062.1| unnamed protein product [Homo sapiens] gi|197127464|gb|ACH43962.1| putative LSM6 homolog U6 small nuclear RNA associated [Taeniopygia guttata] gi|261860094|dbj|BAI46569.1| U6 snRNA-associated Sm-like protein LSm6 [synthetic construct] gi|296478782|tpg|DAA20897.1| TPA: Sm protein F [Bos taurus] gi|344244120|gb|EGW00224.1| U6 snRNA-associated Sm-like protein LSm6 [Cricetulus griseus] gi|351714530|gb|EHB17449.1| U6 snRNA-associated Sm-like protein LSm6 [Heterocephalus glaber] gi|355687640|gb|EHH26224.1| hypothetical protein EGK_16139 [Macaca mulatta] gi|355762049|gb|EHH61876.1| hypothetical protein EGM_20027 [Macaca fascicularis] gi|431918291|gb|ELK17518.1| U6 snRNA-associated Sm-like protein LSm6 [Pteropus alecto] gi|449271295|gb|EMC81755.1| U6 snRNA-associated Sm-like protein LSm6 [Columba livia] gi|465995079|gb|EMP39664.1| U6 snRNA-associated Sm-like protein LSm6, partial [Chelonia mydas] Length = 80 Score = 65.9 bits (159), Expect(2) = 5e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 6 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 41 Score = 50.8 bits (120), Expect(2) = 5e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 54 GQLKNKYGDAFIRGNNVLYISTQK 77 >ref|XP_006023779.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Alligator sinensis] Length = 123 Score = 65.9 bits (159), Expect(2) = 5e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 49 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 84 Score = 50.8 bits (120), Expect(2) = 5e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 97 GQLKNKYGDAFIRGNNVLYISTQK 120 >ref|XP_005995598.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Latimeria chalumnae] Length = 82 Score = 65.9 bits (159), Expect(2) = 5e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 8 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 43 Score = 50.8 bits (120), Expect(2) = 5e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 56 GQLKNKYGDAFIRGNNVLYISTQK 79 >ref|XP_005284336.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X2 [Chrysemys picta bellii] Length = 95 Score = 65.9 bits (159), Expect(2) = 5e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 21 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 56 Score = 50.8 bits (120), Expect(2) = 5e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 69 GQLKNKYGDAFIRGNNVLYISTQK 92 >ref|XP_005284335.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X1 [Chrysemys picta bellii] Length = 118 Score = 65.9 bits (159), Expect(2) = 5e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 44 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 79 Score = 50.8 bits (120), Expect(2) = 5e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 92 GQLKNKYGDAFIRGNNVLYISTQK 115 >ref|XP_005243372.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Falco peregrinus] gi|541975974|ref|XP_005440960.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Falco cherrug] Length = 95 Score = 65.9 bits (159), Expect(2) = 5e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 21 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 56 Score = 50.8 bits (120), Expect(2) = 5e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 69 GQLKNKYGDAFIRGNNVLYISTQK 92 >ref|XP_004941025.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 isoform X3 [Gallus gallus] Length = 106 Score = 65.9 bits (159), Expect(2) = 5e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 32 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 67 Score = 50.8 bits (120), Expect(2) = 5e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 80 GQLKNKYGDAFIRGNNVLYISTQK 103 >ref|XP_004645495.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Octodon degus] Length = 80 Score = 65.9 bits (159), Expect(2) = 5e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 6 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 41 Score = 50.8 bits (120), Expect(2) = 5e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 54 GQLKNKYGDAFIRGNNVLYISTQK 77 >ref|XP_004456556.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform 1 [Dasypus novemcinctus] gi|488529547|ref|XP_004456557.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform 2 [Dasypus novemcinctus] gi|488529549|ref|XP_004456558.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like isoform 3 [Dasypus novemcinctus] Length = 80 Score = 65.9 bits (159), Expect(2) = 5e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 6 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 41 Score = 50.8 bits (120), Expect(2) = 5e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 54 GQLKNKYGDAFIRGNNVLYISTQK 77 >ref|XP_003928047.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6 [Saimiri boliviensis boliviensis] Length = 114 Score = 65.9 bits (159), Expect(2) = 5e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 40 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 75 Score = 50.8 bits (120), Expect(2) = 5e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 88 GQLKNKYGDAFIRGNNVLYISTQK 111 >gb|EKC33396.1| Nucleolar protein 6 [Crassostrea gigas] Length = 1150 Score = 65.5 bits (158), Expect(2) = 6e-18 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 182 LSGTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +S +TP++FLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 1072 MSRKQTPSEFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 1111 Score = 50.8 bits (120), Expect(2) = 6e-18 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAFIRGNNVLYIST K Sbjct: 1124 GQLKNKYGDAFIRGNNVLYISTQK 1147 >ref|XP_005883121.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm6-like [Myotis brandtii] Length = 80 Score = 65.9 bits (159), Expect(2) = 6e-18 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +2 Query: 194 KTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGXM 301 +TP+DFLK I GRPVVVKLNSGVDYRG+LACLDG M Sbjct: 6 QTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYM 41 Score = 50.4 bits (119), Expect(2) = 6e-18 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = +1 Query: 301 GQLKNKYGDAFIRGNNVLYISTSK 372 GQLKNKYGDAF+RGNNVLYIST K Sbjct: 54 GQLKNKYGDAFVRGNNVLYISTQK 77