BLASTX nr result
ID: Mentha22_contig00018118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00018118 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACI62178.1| transcriptional factor WRKY II [Boea hygrometrica] 60 4e-07 gb|EYU25197.1| hypothetical protein MIMGU_mgv1a019981mg [Mimulus... 59 9e-07 tpg|DAA49067.1| TPA: putative WRKY DNA-binding domain superfamil... 57 3e-06 ref|NP_001150829.1| WRKY69 - superfamily of TFs having WRKY and ... 57 3e-06 gb|ACF82210.1| unknown [Zea mays] 57 3e-06 gb|EYU40023.1| hypothetical protein MIMGU_mgv1a009487mg [Mimulus... 56 5e-06 ref|XP_006350583.1| PREDICTED: probable WRKY transcription facto... 56 5e-06 gb|AGQ04247.1| WRKY transcription factor 53 [Jatropha curcas] 56 5e-06 ref|XP_004234275.1| PREDICTED: probable WRKY transcription facto... 56 5e-06 >gb|ACI62178.1| transcriptional factor WRKY II [Boea hygrometrica] Length = 259 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 GVEGQLDDGYGWRKYGQKEILGAKHPRYLY 91 G+EGQL+DGYGWRKYGQK+ILGAK+PR Y Sbjct: 123 GIEGQLEDGYGWRKYGQKDILGAKYPRNYY 152 >gb|EYU25197.1| hypothetical protein MIMGU_mgv1a019981mg [Mimulus guttatus] Length = 356 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 GVEGQLDDGYGWRKYGQKEILGAKHPRYLY 91 G EGQLDDGYGWRKYGQK+ILGAK+PR Y Sbjct: 123 GNEGQLDDGYGWRKYGQKDILGAKYPRGYY 152 >tpg|DAA49067.1| TPA: putative WRKY DNA-binding domain superfamily protein [Zea mays] Length = 333 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +2 Query: 2 GVEGQLDDGYGWRKYGQKEILGAKHPRYLY 91 G EG +DDGY WRKYGQK+ILGAKHPR Y Sbjct: 124 GAEGPVDDGYSWRKYGQKDILGAKHPRAYY 153 >ref|NP_001150829.1| WRKY69 - superfamily of TFs having WRKY and zinc finger domains [Zea mays] gi|195642220|gb|ACG40578.1| WRKY69 - superfamily of TFs having WRKY and zinc finger domains [Zea mays] Length = 331 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +2 Query: 2 GVEGQLDDGYGWRKYGQKEILGAKHPRYLY 91 G EG +DDGY WRKYGQK+ILGAKHPR Y Sbjct: 124 GAEGPVDDGYSWRKYGQKDILGAKHPRAYY 153 >gb|ACF82210.1| unknown [Zea mays] Length = 335 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +2 Query: 2 GVEGQLDDGYGWRKYGQKEILGAKHPRYLY 91 G EG +DDGY WRKYGQK+ILGAKHPR Y Sbjct: 128 GAEGPVDDGYSWRKYGQKDILGAKHPRAYY 157 >gb|EYU40023.1| hypothetical protein MIMGU_mgv1a009487mg [Mimulus guttatus] Length = 340 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +2 Query: 2 GVEGQLDDGYGWRKYGQKEILGAKHPRYLY 91 G+EG DDGY WRKYGQK+ILGAKHPR Y Sbjct: 127 GLEGPTDDGYSWRKYGQKDILGAKHPRSYY 156 >ref|XP_006350583.1| PREDICTED: probable WRKY transcription factor 41-like [Solanum tuberosum] Length = 356 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +2 Query: 5 VEGQLDDGYGWRKYGQKEILGAKHPRYLY 91 +EG LDDGY WRKYGQK+ILGAKHPR Y Sbjct: 138 IEGTLDDGYSWRKYGQKDILGAKHPRGYY 166 >gb|AGQ04247.1| WRKY transcription factor 53 [Jatropha curcas] Length = 357 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 2 GVEGQLDDGYGWRKYGQKEILGAKHPRYLY 91 G+EG LDDG+ WRKYGQK+ILGAKHPR Y Sbjct: 121 GLEGPLDDGFSWRKYGQKDILGAKHPRGYY 150 >ref|XP_004234275.1| PREDICTED: probable WRKY transcription factor 41-like [Solanum lycopersicum] Length = 353 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = +2 Query: 5 VEGQLDDGYGWRKYGQKEILGAKHPRYLY 91 +EG LDDGY WRKYGQK+ILGAKHPR Y Sbjct: 137 IEGTLDDGYSWRKYGQKDILGAKHPRGYY 165