BLASTX nr result
ID: Mentha22_contig00017847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00017847 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19124.1| hypothetical protein MIMGU_mgv1a016364mg [Mimulus... 79 8e-13 gb|EYU19087.1| hypothetical protein MIMGU_mgv1a016369mg [Mimulus... 77 2e-12 ref|XP_004293880.1| PREDICTED: 50S ribosomal protein L20-like is... 74 2e-11 ref|XP_007212231.1| hypothetical protein PRUPE_ppa013387mg [Prun... 73 4e-11 ref|XP_006353017.1| PREDICTED: 50S ribosomal protein L20, chloro... 73 5e-11 ref|XP_004233169.1| PREDICTED: 50S ribosomal protein L20-like [S... 72 6e-11 gb|EMS67561.1| 50S ribosomal protein L20 [Triticum urartu] gi|47... 69 9e-10 ref|XP_002268463.1| PREDICTED: 50S ribosomal protein L20 [Vitis ... 67 3e-09 ref|NP_001044164.1| Os01g0734100 [Oryza sativa Japonica Group] g... 67 3e-09 ref|NP_001151809.1| 50S ribosomal protein L20 [Zea mays] gi|2269... 66 6e-09 ref|XP_004969858.1| PREDICTED: 50S ribosomal protein L20, chloro... 65 7e-09 ref|XP_003569741.1| PREDICTED: 50S ribosomal protein L20-like [B... 65 7e-09 dbj|BAK05413.1| predicted protein [Hordeum vulgare subsp. vulgare] 65 7e-09 ref|XP_006654683.1| PREDICTED: 50S ribosomal protein L20, chloro... 65 1e-08 ref|XP_004139908.1| PREDICTED: 50S ribosomal protein L20-like is... 65 1e-08 ref|XP_003568051.1| PREDICTED: 50S ribosomal protein L20-like [B... 65 1e-08 gb|EAY98774.1| hypothetical protein OsI_20708 [Oryza sativa Indi... 65 1e-08 ref|NP_001056116.1| Os05g0528200 [Oryza sativa Japonica Group] g... 65 1e-08 ref|XP_006644665.1| PREDICTED: 50S ribosomal protein L20, chloro... 64 2e-08 tpg|DAA57761.1| TPA: hypothetical protein ZEAMMB73_608772 [Zea m... 64 2e-08 >gb|EYU19124.1| hypothetical protein MIMGU_mgv1a016364mg [Mimulus guttatus] Length = 124 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSE+SMHE YSFKALVD+SR+AFPGNKAA PKK+GLA+LV Sbjct: 80 NRKVLSEISMHEPYSFKALVDVSRTAFPGNKAAVPPKKQGLAMLV 124 >gb|EYU19087.1| hypothetical protein MIMGU_mgv1a016369mg [Mimulus guttatus] Length = 124 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSE+SMHE YSFKALVD+SR+AFPGNKA PKK+GLA+LV Sbjct: 80 NRKVLSEISMHEPYSFKALVDVSRTAFPGNKAVVPPKKQGLAMLV 124 >ref|XP_004293880.1| PREDICTED: 50S ribosomal protein L20-like isoform 1 [Fragaria vesca subsp. vesca] gi|470115381|ref|XP_004293881.1| PREDICTED: 50S ribosomal protein L20-like isoform 2 [Fragaria vesca subsp. vesca] Length = 124 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSE+SMHE Y+FKALVD+S SAFPGNKA PKKEGL IL+ Sbjct: 80 NRKVLSEISMHEPYTFKALVDVSHSAFPGNKAVVPPKKEGLQILL 124 >ref|XP_007212231.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica] gi|595877140|ref|XP_007212232.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica] gi|596292982|ref|XP_007226592.1| hypothetical protein PRUPE_ppa023673mg [Prunus persica] gi|462408096|gb|EMJ13430.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica] gi|462408097|gb|EMJ13431.1| hypothetical protein PRUPE_ppa013387mg [Prunus persica] gi|462423528|gb|EMJ27791.1| hypothetical protein PRUPE_ppa023673mg [Prunus persica] Length = 125 Score = 73.2 bits (178), Expect = 4e-11 Identities = 38/46 (82%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNK-AAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVDISR+AFPGNK APKKEGL++LV Sbjct: 80 NRKVLSELSMHEPYSFKALVDISRTAFPGNKNVVHAPKKEGLSMLV 125 >ref|XP_006353017.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Solanum tuberosum] Length = 125 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGN-KAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SRSAFPGN K+ PKKEGLAI++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSRSAFPGNKKSIVPPKKEGLAIVL 125 >ref|XP_004233169.1| PREDICTED: 50S ribosomal protein L20-like [Solanum lycopersicum] Length = 125 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/46 (78%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGN-KAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SRSAFPGN K+ PKKEGLA+++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSRSAFPGNKKSIVPPKKEGLAVVL 125 >gb|EMS67561.1| 50S ribosomal protein L20 [Triticum urartu] gi|475615998|gb|EMT29617.1| 50S ribosomal protein L20 [Aegilops tauschii] Length = 122 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SR+AFPGN+ AA KKEGLA ++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSRTAFPGNRPAA--KKEGLASIL 122 >ref|XP_002268463.1| PREDICTED: 50S ribosomal protein L20 [Vitis vinifera] gi|147832535|emb|CAN74888.1| hypothetical protein VITISV_041868 [Vitis vinifera] gi|296087520|emb|CBI34109.3| unnamed protein product [Vitis vinifera] Length = 125 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/46 (69%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGN-KAAAAPKKEGLAILV 208 NRKVLSELSMHE Y+FKALVDIS++AFPGN KA P+KEG+++++ Sbjct: 80 NRKVLSELSMHEPYTFKALVDISQNAFPGNKKAVLPPRKEGISVVL 125 >ref|NP_001044164.1| Os01g0734100 [Oryza sativa Japonica Group] gi|15624022|dbj|BAB68076.1| putative 50S ribosomal protein L20 [Oryza sativa Japonica Group] gi|20161006|dbj|BAB89939.1| putative 50S ribosomal protein L20 [Oryza sativa Japonica Group] gi|113533695|dbj|BAF06078.1| Os01g0734100 [Oryza sativa Japonica Group] gi|215693931|dbj|BAG89130.1| unnamed protein product [Oryza sativa Japonica Group] gi|218189012|gb|EEC71439.1| hypothetical protein OsI_03640 [Oryza sativa Indica Group] gi|222619213|gb|EEE55345.1| hypothetical protein OsJ_03363 [Oryza sativa Japonica Group] Length = 122 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SRSAFPGN+ KKEGLA ++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSRSAFPGNRPPV--KKEGLAAIL 122 >ref|NP_001151809.1| 50S ribosomal protein L20 [Zea mays] gi|226958655|ref|NP_001152923.1| LOC100280565 [Zea mays] gi|242091177|ref|XP_002441421.1| hypothetical protein SORBIDRAFT_09g026330 [Sorghum bicolor] gi|514747670|ref|XP_004961424.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Setaria italica] gi|195605838|gb|ACG24749.1| 50S ribosomal protein L20 [Zea mays] gi|195649829|gb|ACG44382.1| 50S ribosomal protein L20 [Zea mays] gi|241946706|gb|EES19851.1| hypothetical protein SORBIDRAFT_09g026330 [Sorghum bicolor] gi|413949894|gb|AFW82543.1| 50S ribosomal protein L20 isoform 1 [Zea mays] gi|413949895|gb|AFW82544.1| 50S ribosomal protein L20 isoform 2 [Zea mays] Length = 122 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SR+AFPGN+ P KEGLA ++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSRNAFPGNR--PVPAKEGLASIL 122 >ref|XP_004969858.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Setaria italica] Length = 121 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SR+AFPGN+ KKEGLA ++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSRTAFPGNRPV---KKEGLAAIL 121 >ref|XP_003569741.1| PREDICTED: 50S ribosomal protein L20-like [Brachypodium distachyon] Length = 122 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SR+AFPGN+ A +KEGLA ++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSRTAFPGNRPPA--QKEGLAAIL 122 >dbj|BAK05413.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 122 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SR+AFPGN+ A +KEGLA ++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSRTAFPGNRPPA--QKEGLAAIL 122 >ref|XP_006654683.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like isoform X1 [Oryza brachyantha] gi|573944675|ref|XP_006654684.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like isoform X2 [Oryza brachyantha] Length = 120 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SR+AFPGN+ P KEGLA ++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSRTAFPGNR----PVKEGLASIL 120 >ref|XP_004139908.1| PREDICTED: 50S ribosomal protein L20-like isoform 1 [Cucumis sativus] gi|449444292|ref|XP_004139909.1| PREDICTED: 50S ribosomal protein L20-like isoform 2 [Cucumis sativus] gi|449444294|ref|XP_004139910.1| PREDICTED: 50S ribosomal protein L20-like isoform 3 [Cucumis sativus] gi|449444296|ref|XP_004139911.1| PREDICTED: 50S ribosomal protein L20-like isoform 4 [Cucumis sativus] gi|449475856|ref|XP_004154571.1| PREDICTED: 50S ribosomal protein L20-like isoform 1 [Cucumis sativus] gi|449475859|ref|XP_004154572.1| PREDICTED: 50S ribosomal protein L20-like isoform 2 [Cucumis sativus] gi|449475863|ref|XP_004154573.1| PREDICTED: 50S ribosomal protein L20-like isoform 3 [Cucumis sativus] Length = 125 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSE+SMHE YSFKALVDISR+AFPGNK P K+ A ++ Sbjct: 80 NRKVLSEISMHEPYSFKALVDISRNAFPGNKNVVFPPKKDAASMI 124 >ref|XP_003568051.1| PREDICTED: 50S ribosomal protein L20-like [Brachypodium distachyon] Length = 121 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SR+AFPGN+ KKEGLA ++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSRTAFPGNRPV---KKEGLASIL 121 >gb|EAY98774.1| hypothetical protein OsI_20708 [Oryza sativa Indica Group] gi|222632308|gb|EEE64440.1| hypothetical protein OsJ_19285 [Oryza sativa Japonica Group] Length = 151 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SR+AFPGN+ KKEGLA ++ Sbjct: 110 NRKVLSELSMHEPYSFKALVDVSRTAFPGNRPV---KKEGLASIL 151 >ref|NP_001056116.1| Os05g0528200 [Oryza sativa Japonica Group] gi|52353395|gb|AAU43963.1| putative 50S ribosomal protein L20 [Oryza sativa Japonica Group] gi|113579667|dbj|BAF18030.1| Os05g0528200 [Oryza sativa Japonica Group] gi|215693127|dbj|BAG88509.1| unnamed protein product [Oryza sativa Japonica Group] Length = 121 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SR+AFPGN+ KKEGLA ++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSRTAFPGNRPV---KKEGLASIL 121 >ref|XP_006644665.1| PREDICTED: 50S ribosomal protein L20, chloroplastic-like [Oryza brachyantha] Length = 122 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+S SAFPGN+ KKEGLA ++ Sbjct: 80 NRKVLSELSMHEPYSFKALVDVSSSAFPGNRPPV--KKEGLAAIL 122 >tpg|DAA57761.1| TPA: hypothetical protein ZEAMMB73_608772 [Zea mays] Length = 76 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -2 Query: 342 NRKVLSELSMHESYSFKALVDISRSAFPGNKAAAAPKKEGLAILV 208 NRKVLSELSMHE YSFKALVD+SR+ FPGN+ KKEGLA ++ Sbjct: 35 NRKVLSELSMHEPYSFKALVDVSRTGFPGNRPV---KKEGLAAIL 76