BLASTX nr result
ID: Mentha22_contig00016515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00016515 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23034.1| hypothetical protein MIMGU_mgv1a007000mg [Mimulus... 65 1e-08 gb|EXB76242.1| Myristoyl-acyl carrier protein thioesterase [Moru... 57 3e-06 gb|AGC31683.1| chloroplast acyl-acylcarrier protein thioesterase... 57 3e-06 gb|ACQ57190.1| acyl acyl-carrier-protein thioesterase type B [Ca... 56 6e-06 gb|ACQ57189.1| acyl acyl-carrier-protein thioesterase type B [Ca... 56 6e-06 gb|ACQ63293.1| acyl acyl-carrier-protein thioesterase type B [Ca... 55 8e-06 >gb|EYU23034.1| hypothetical protein MIMGU_mgv1a007000mg [Mimulus guttatus] gi|604303611|gb|EYU23035.1| hypothetical protein MIMGU_mgv1a007000mg [Mimulus guttatus] gi|604303612|gb|EYU23036.1| hypothetical protein MIMGU_mgv1a007000mg [Mimulus guttatus] gi|604303613|gb|EYU23037.1| hypothetical protein MIMGU_mgv1a007000mg [Mimulus guttatus] gi|604303614|gb|EYU23038.1| hypothetical protein MIMGU_mgv1a007000mg [Mimulus guttatus] Length = 423 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 304 LLRLEGGGEIVKGRTKWRPKFVDKIGMLGQLPEENA 197 LLRLEGGGEIVKGRTKWRPK+ D+IG LGQ P E+A Sbjct: 388 LLRLEGGGEIVKGRTKWRPKYPDRIGSLGQFPAESA 423 >gb|EXB76242.1| Myristoyl-acyl carrier protein thioesterase [Morus notabilis] Length = 417 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 304 LLRLEGGGEIVKGRTKWRPKFVDKIGMLGQLPEENA 197 LLRLE G EIV+GRT+WRPK + +G +G+LPEENA Sbjct: 382 LLRLENGAEIVRGRTEWRPKHANNLGTMGELPEENA 417 >gb|AGC31683.1| chloroplast acyl-acylcarrier protein thioesterase B [Lonicera japonica] gi|441433569|gb|AGC31684.1| chloroplast acyl-acylcarrier protein thioesterase B [Lonicera japonica var. chinensis] Length = 422 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -3 Query: 304 LLRLEGGGEIVKGRTKWRPKFVDKIGMLGQLPEENA 197 LLRLEGG EIVKGRT+WRPK+ +++G LG LP E A Sbjct: 387 LLRLEGGAEIVKGRTEWRPKYPNRLGTLGALPAERA 422 >gb|ACQ57190.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 434 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 304 LLRLEGGGEIVKGRTKWRPKFVDKIGMLGQLPEENA 197 LLRLEGG EIVKGRT+WRPK+ + +G LG LP E++ Sbjct: 399 LLRLEGGAEIVKGRTEWRPKYANCVGTLGSLPAESS 434 >gb|ACQ57189.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 420 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 304 LLRLEGGGEIVKGRTKWRPKFVDKIGMLGQLPEENA 197 LLRLEGG EIVKGRT+WRPK+ + +G LG LP E++ Sbjct: 385 LLRLEGGAEIVKGRTEWRPKYANCVGTLGSLPTESS 420 >gb|ACQ63293.1| acyl acyl-carrier-protein thioesterase type B [Camellia oleifera] Length = 434 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 304 LLRLEGGGEIVKGRTKWRPKFVDKIGMLGQLPEENA 197 LLRLEGG EIVKGRT+WRPK+ + +G LG LP E++ Sbjct: 399 LLRLEGGAEIVKGRTEWRPKYANCLGTLGSLPAESS 434